IL32 Antibody - #DF8566
| Product: | IL32 Antibody |
| Catalog: | DF8566 |
| Description: | Rabbit polyclonal antibody to IL32 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 26 kDa; 27kD(Calculated). |
| Uniprot: | P24001 |
| RRID: | AB_2841770 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8566, RRID:AB_2841770.
Fold/Unfold
IL 32alpha; IL 32beta; IL 32delta; IL 32gamma; IL-32; IL32; IL32_HUMAN; Interleukin 32; Interleukin 32 small; Interleukin 32 theta; Interleukin-32; interleukin-32 eta; Natural killer cell transcript 4; Natural killer cells protein 4; NK 4; NK4; OTTHUMP00000236040; OTTHUMP00000236041; OTTHUMP00000236042; OTTHUMP00000236043; OTTHUMP00000236044; OTTHUMP00000236045; OTTHUMP00000236046; OTTHUMP00000236047; OTTHUMP00000236048; OTTHUMP00000236049; OTTHUMP00000236050; OTTHUMP00000236051; OTTHUMP00000236052; OTTHUMP00000236053; OTTHUMP00000236054; OTTHUMP00000241545; OTTHUMP00000241602; OTTHUMP00000241603; OTTHUMP00000241604; OTTHUMP00000241605; OTTHUMP00000241606; OTTHUMP00000241607; OTTHUMP00000241608; OTTHUMP00000241609; OTTHUMP00000241610; OTTHUMP00000241611; OTTHUMP00000241612; TAIF; TAIFa; TAIFb; TAIFc; TAIFd; Tumor necrosis factor alpha-inducing factor;
Immunogens
A synthesized peptide derived from human IL32, corresponding to a region within the internal amino acids.
Selectively expressed in lymphocytes. Expression is more prominent in immune cells than in non-immune cells.
- P24001 IL32_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLCLSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK
Research Backgrounds
Cytokine that may play a role in innate and adaptive immune responses. It induces various cytokines such as TNFA/TNF-alpha and IL8. It activates typical cytokine signal pathways of NF-kappa-B and p38 MAPK.
Secreted.
Selectively expressed in lymphocytes. Expression is more prominent in immune cells than in non-immune cells.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.