OBCAM Antibody - #DF8584

Product: | OBCAM Antibody |
Catalog: | DF8584 |
Description: | Rabbit polyclonal antibody to OBCAM |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 38 kDa; 38kD(Calculated). |
Uniprot: | Q14982 |
RRID: | AB_2841788 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8584, RRID:AB_2841788.
Fold/Unfold
GM181; IgLON family member 1; IGLON1; OBCAM; OPCM; OPCM_HUMAN; OPCML; Opiate binding cell adhesion molecule; Opioid binding cell adhesion molecule; Opioid binding protein/cell adhesion molecule; Opioid binding protein/cell adhesion molecule-like; Opioid binding protein/cell adhesion molecule-like preprotein; Opioid-binding cell adhesion molecule; Opioid-binding protein/cell adhesion molecule;
Immunogens
- Q14982 OPCM_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYGPGAVIDGVNSASRALACLWLSGTLLAHFFIKF
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q14982 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K217 | Ubiquitination | Uniprot | |
K228 | Ubiquitination | Uniprot |
Research Backgrounds
Binds opioids in the presence of acidic lipids; probably involved in cell contact.
Cell membrane>Lipid-anchor.
Belongs to the immunoglobulin superfamily. IgLON family.
References
Application: WB Species: Human Sample: melanoma A375 cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.