SOX11 Antibody - #DF8614
| Product: | SOX11 Antibody |
| Catalog: | DF8614 |
| Description: | Rabbit polyclonal antibody to SOX11 |
| Application: | WB IF/ICC |
| Cited expt.: | IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Horse, Sheep, Rabbit, Chicken, Xenopus |
| Mol.Wt.: | 46 kDa,55kDa; 47kD(Calculated). |
| Uniprot: | P35716 |
| RRID: | AB_2841818 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8614, RRID:AB_2841818.
Fold/Unfold
MRD27; SOX11; SOX11_HUMAN; SRY (sex determining region Y) box 11; SRY related HMG box gene 11; SRY-box 11; Transcription factor SOX-11;
Immunogens
A synthesized peptide derived from human SOX11, corresponding to a region within C-terminal amino acids.
Expressed mainly in the nervous system, brain (fetus and adult) and hear (adult).
- P35716 SOX11_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKKCGKLKAPAAAGAKAGAGKAAQSGDYGGAGDDYVLGSLRVSGSGGGGAGKTVKCVFLDEDDDDDDDDDELQLQIKQEPDEEDEEPPHQQLLQPPGQQPSQLLRRYNVAKVPASPTLSSSAESPEGASLYDEVRAGATSGAGGGSRLYYSFKNITKQHPPPLAQPALSPASSRSVSTSSSSSSGSSSGSSGEDADDLMFDLSLNFSQSAHSASEQQLGGGAAAGNLSLSLVDKDLDSFSEGSLGSHFEFPDYCTPELSEMIAGDWLEANFSDLVFTY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Transcriptional factor involved in the embryonic neurogenesis. May also have a role in tissue modeling during development.
Nucleus.
Expressed mainly in the nervous system, brain (fetus and adult) and hear (adult).
References
Application: IF/ICC Species: Rat Sample:
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.