Product: SP-B Antibody
Catalog: DF8615
Description: Rabbit polyclonal antibody to SP-B
Application: WB IHC
Cited expt.: WB
Reactivity: Human
Mol.Wt.: 42 kDa; 42kD(Calculated).
Uniprot: P07988
RRID: AB_2841819

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IHC 1:50-1:200, WB 1:1000-3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
SP-B Antibody detects endogenous levels of total SP-B.
RRID:
AB_2841819
Cite Format: Affinity Biosciences Cat# DF8615, RRID:AB_2841819.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

18 kDa pulmonary-surfactant protein; 6 kDa protein; PSP B; PSPB; PSPB_HUMAN; Pulmonary surfactant apoprotein PSP-B; Pulmonary surfactant-associated protein B; Pulmonary surfactant-associated protein, 18-KD; Pulmonary surfactant-associated proteolipid SPL(Phe); SFTB3; SFTP3; SFTPB; SMDP1; SP B; SP-B; SPB; surfactant protein B; Surfactant, pulmonary-associated protein B; surfactant-associated protein, pulmonary, 3;

Immunogens

Immunogen:

A synthesized peptide derived from human SP-B, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Sequence:
MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL

Research Backgrounds

Function:

Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.

Subcellular Location:

Secreted>Extracellular space>Surface film.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location

References

1). miR-296-5p Inhibits the Secretion of Pulmonary Surfactants in Pulmonary Epithelial Cells via the Downregulation of Wnt7b/β-Catenin Signaling. Biomed Research International, 2021 (PubMed: 33490270) [IF=2.6]

Application: WB    Species: Human    Sample: A549 cell

Figure 4 miR-296-5p inhibited the expression of SP-A (SFTPA1) and SP-B through the Wnt signaling pathway. After transfection of mir-296-5p overexpression and empty vectors in the A549 cell line, the expression of WNT7B, β-catenin, SP-A, and SP-B was assessed using western blotting.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.