SP-B Antibody - #DF8615

Product: | SP-B Antibody |
Catalog: | DF8615 |
Description: | Rabbit polyclonal antibody to SP-B |
Application: | WB IHC |
Cited expt.: | WB |
Reactivity: | Human |
Mol.Wt.: | 42 kDa; 42kD(Calculated). |
Uniprot: | P07988 |
RRID: | AB_2841819 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8615, RRID:AB_2841819.
Fold/Unfold
18 kDa pulmonary-surfactant protein; 6 kDa protein; PSP B; PSPB; PSPB_HUMAN; Pulmonary surfactant apoprotein PSP-B; Pulmonary surfactant-associated protein B; Pulmonary surfactant-associated protein, 18-KD; Pulmonary surfactant-associated proteolipid SPL(Phe); SFTB3; SFTP3; SFTPB; SMDP1; SP B; SP-B; SPB; surfactant protein B; Surfactant, pulmonary-associated protein B; surfactant-associated protein, pulmonary, 3;
Immunogens
A synthesized peptide derived from human SP-B, corresponding to a region within the internal amino acids.
- P07988 PSPB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL
Research Backgrounds
Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
Secreted>Extracellular space>Surface film.
References
Application: WB Species: Human Sample: A549 cell
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.