JTB Antibody - #DF8670
| Product: | JTB Antibody |
| Catalog: | DF8670 |
| Description: | Rabbit polyclonal antibody to JTB |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Prediction: | Pig, Bovine, Sheep, Rabbit |
| Mol.Wt.: | 16 kDa; 16kD(Calculated). |
| Uniprot: | O76095 |
| RRID: | AB_2841874 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8670, RRID:AB_2841874.
Fold/Unfold
hJT; HJTB; HSPC222; JTB; JTB_HUMAN; Jumping translocation breakpoint; Jumping translocation breakpoint protein; OTTHUMP00000034759; PAR; PAR protein; Prostate androgen regulated protein; Prostate androgen-regulated protein; Protein JTB;
Immunogens
Ubiquitous. Expressed in all normal human tissues studied but overexpressed or underexpressed in many of their malignant counterparts.
- O76095 JTB_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLAGAGRPGLPQGRHLCWLLCAFTLKLCQAEAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRLFWKFEGAVVCVALIFACLVIIRQRQLDRKALEKVRKQIESI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O76095 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K38 | Ubiquitination | Uniprot | |
| K69 | Ubiquitination | Uniprot | |
| K82 | Ubiquitination | Uniprot | |
| K138 | Ubiquitination | Uniprot | |
| K141 | Ubiquitination | Uniprot | |
| S145 | Phosphorylation | Uniprot |
Research Backgrounds
Required for normal cytokinesis during mitosis. Plays a role in the regulation of cell proliferation. May be a component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Increases AURKB activity. Inhibits apoptosis induced by TGFB1 (By similarity). Overexpression induces swelling of mitochondria and reduces mitochondrial membrane potential (By similarity).
Membrane>Single-pass type I membrane protein. Mitochondrion. Cytoplasm. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Cytoplasm>Cytoskeleton>Spindle.
Note: Detected at the centrosome and along spindle fibers during prophase and metaphase. Detected at the midbody during telophase.
Ubiquitous. Expressed in all normal human tissues studied but overexpressed or underexpressed in many of their malignant counterparts.
Interacts with AURKA, AURKB, BIRC5 and INCENP. May be a component of the CPC at least composed of BIRC5/survivin, CDCA8/borealin, INCENP and AURKB/Aurora-B.
Belongs to the JTB family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.