KLHL3 Antibody - #DF8672
| Product: | KLHL3 Antibody |
| Catalog: | DF8672 |
| Description: | Rabbit polyclonal antibody to KLHL3 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Bovine, Horse, Sheep, Rabbit |
| Mol.Wt.: | 64 kDa; 65kD(Calculated). |
| Uniprot: | Q9UH77 |
| RRID: | AB_2841876 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8672, RRID:AB_2841876.
Fold/Unfold
FLJ40871; kelch (Drosophila) like 3; kelch like 3 (Drosophila); kelch like 3; Kelch like protein 3; KIAA1129; KLHL 3; KLHL3; MGC44594;
Immunogens
- Q9UH77 KLHL3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEGESVKLSSQTLIQAGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLCDVMIVAEDVEIEAHRVVLAACSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYTAEIEVTEENVQVLLPAASLLQLMDVRQNCCDFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHFPEVMLGEEFLSLSLDQVCSLISSDKLTVSSEEKVFEAVISWINYEKETRLEHMAKLMEHVRLPLLPRDYLVQTVEEEALIKNNNTCKDFLIEAMKYHLLPLDQRLLIKNPRTKPRTPVSLPKVMIVVGGQAPKAIRSVECYDFEEDRWDQIAELPSRRCRAGVVFMAGHVYAVGGFNGSLRVRTVDVYDGVKDQWTSIASMQERRSTLGAAVLNDLLYAVGGFDGSTGLASVEAYSYKTNEWFFVAPMNTRRSSVGVGVVEGKLYAVGGYDGASRQCLSTVEQYNPATNEWIYVADMSTRRSGAGVGVLSGQLYATGGHDGPLVRKSVEVYDPGTNTWKQVADMNMCRRNAGVCAVNGLLYVVGGDDGSCNLASVEYYNPVTDKWTLLPTNMSTGRSYAGVAVIHKSL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UH77 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S9 | Phosphorylation | Uniprot | |
| S10 | Phosphorylation | Uniprot | |
| T12 | Phosphorylation | Uniprot | |
| T100 | Phosphorylation | Uniprot | |
| S208 | Phosphorylation | Uniprot | |
| S209 | Phosphorylation | Uniprot | |
| T291 | Phosphorylation | Uniprot | |
| T295 | Phosphorylation | Uniprot | |
| T375 | Phosphorylation | Uniprot | |
| S376 | Phosphorylation | Uniprot | |
| S433 | Phosphorylation | P17612 (PRKACA) | Uniprot |
| K518 | Methylation | Uniprot | |
| S576 | Phosphorylation | Uniprot | |
| Y577 | Phosphorylation | Uniprot |
Research Backgrounds
Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that acts as a regulator of ion transport in the distal nephron. The BCR(KLHL3) complex acts by mediating ubiquitination of WNK4, an inhibitor of potassium channel KCNJ1, leading to WNK4 degradation. The BCR(KLHL3) complex also mediates ubiquitination and degradation of CLDN8, a tight-junction protein required for paracellular chloride transport in the kidney (By similarity).
Phosphorylation at Ser-433 by PKA decreases the interaction with WNK4, Leading to inhibit WNK4 degradation by the BCR(KLHL3) complex. Phosphorylation at Ser-433 is increased by insulin.
Cytoplasm>Cytoskeleton. Cytoplasm>Cytosol.
Widely expressed.
Homodimer. Component of the BCR(KLHL3) E3 ubiquitin ligase complex, at least composed of CUL3 and KLHL3 and RBX1 (Probable). Interacts with SLC12A3. Interacts with WNK1 and WNK4. Interacts with CLDN8 (By similarity).
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.