LEG4 Antibody - #DF8674
| Product: | LEG4 Antibody |
| Catalog: | DF8674 |
| Description: | Rabbit polyclonal antibody to LEG4 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Horse, Rabbit |
| Mol.Wt.: | 35 kDa; 36kD(Calculated). |
| Uniprot: | P56470 |
| RRID: | AB_2841878 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8674, RRID:AB_2841878.
Fold/Unfold
Antigen NY CO 27; Antigen NY-CO-27; Antigen NYCO27; GAL 4; Gal-4; GAL4; Galectin 4; Galectin-4; Galectin4; Homo sapiens galectin4 mRNA complete cds; L 36 lactose binding protein; L-36 lactose-binding protein; L36 lactose binding protein; L36LBP; Lactose binding lectin 4; Lactose-binding lectin 4; Lectin galactoside binding soluble 4; LEG4_HUMAN; LGALS4;
Immunogens
A synthesized peptide derived from human LEG4, corresponding to a region within N-terminal amino acids.
- P56470 LEG4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Galectin that binds lactose and a related range of sugars. May be involved in the assembly of adherens junctions.
Contains two homologous but distinct carbohydrate-binding domains.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.