ZNF23 Antibody - #DF8734
| Product: | ZNF23 Antibody |
| Catalog: | DF8734 |
| Description: | Rabbit polyclonal antibody to ZNF23 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Monkey |
| Mol.Wt.: | 73 kDa; 73kD(Calculated). |
| Uniprot: | P17027 |
| RRID: | AB_2841938 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8734, RRID:AB_2841938.
Fold/Unfold
KOX16; Kruppel like zinc finger factor X31; MGC57283; OTTHUMP00000174920; OTTHUMP00000174921; Zfp612; Zinc finger protein 23; zinc finger protein 32; Zinc finger protein 359; Zinc finger protein 612; Zinc finger protein KOX16; ZNF23; ZNF23_HUMAN; ZNF359; ZNF612;
Immunogens
A synthesized peptide derived from human ZNF23, corresponding to a region within the internal amino acids.
- P17027 ZNF23_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLENYGNVASLGFPLLKPAVISQLEGGSELGGSSPLAAGTGLQGLQTDIQTDNDLTKEMYEGKENVSFELQRDFSQETDFSEASLLEKQQEVHSAGNIKKEKSNTIDGTVKDETSPVEECFFSQSSNSYQCHTITGEQPSGCTGLGKSISFDTKLVKHEIINSEERPFKCEELVEPFRCDSQLIQHQENNTEEKPYQCSECGKAFSINEKLIWHQRLHSGEKPFKCVECGKSFSYSSHYITHQTIHSGEKPYQCKMCGKAFSVNGSLSRHQRIHTGEKPYQCKECGNGFSCSSAYITHQRVHTGEKPYECNDCGKAFNVNAKLIQHQRIHTGEKPYECNECGKGFRCSSQLRQHQSIHTGEKPYQCKECGKGFNNNTKLIQHQRIHTGEKPYECTECGKAFSVKGKLIQHQRIHTGEKPYECNECGKAFRCNSQFRQHLRIHTGEKPYECNECGKAFSVNGKLMRHQRIHTGEKPFECNECGRCFTSKRNLLDHHRIHTGEKPYQCKECGKAFSINAKLTRHQRIHTGEKPFKCMECEKAFSCSSNYIVHQRIHTGEKPFQCKECGKAFHVNAHLIRHQRSHTGEKPFRCVECGKGFSFSSDYIIHQTVHTWKKPYMCSVCGKAFRFSFQLSQHQSVHSEGKS
Research Backgrounds
May be involved in transcriptional regulation. May have a role in embryonic development.
Nucleus.
Belongs to the krueppel C2H2-type zinc-finger protein family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.