TGIF2LY Antibody - #DF8751
Product: | TGIF2LY Antibody |
Catalog: | DF8751 |
Description: | Rabbit polyclonal antibody to TGIF2LY |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 21 kDa; 21kD(Calculated). |
Uniprot: | Q8IUE0 |
RRID: | AB_2841955 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8751, RRID:AB_2841955.
Fold/Unfold
Homeobox protein TGIF2LY; TF2LY_HUMAN; TGF(beta)induced transcription factor 2-like protein; TGF-beta-induced transcription factor 2-like protein; TGFB-induced factor 2-like protein; TGFB-induced factor 2-like protein, Y-linked; TGFB-induced factor homeobox 2-like, Y-linked; TGIF-like on the Y; TGIF2LY; TGIFLY; Transforming growth factor-beta-induced factor 2-like, Y-linked; Y-linked;
Immunogens
A synthesized peptide derived from human TGIF2LY, corresponding to a region within the internal amino acids.
- Q8IUE0 TF2LY_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLRISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGPVVQTMYKACPCGPCQRARCQERSNQIRSRPLARSSPE
Research Backgrounds
May have a transcription role in testis. May act as a competitor/regulator of TGIF2LX.
Nucleus.
Specifically expressed in adult testis.
Belongs to the TALE/TGIF homeobox family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.