SNAPC5 Antibody - #DF8764
| Product: | SNAPC5 Antibody |
| Catalog: | DF8764 |
| Description: | Rabbit polyclonal antibody to SNAPC5 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Dog |
| Mol.Wt.: | 11 kDa; 11kD(Calculated). |
| Uniprot: | O75971 |
| RRID: | AB_2841968 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8764, RRID:AB_2841968.
Fold/Unfold
Small nuclear RNA activating complex polypeptide 5 19kDa; Small nuclear RNA activating complex polypeptide 5; SNAP 19; SNAP19; SNAPc 19 kDa subunit; SNAPC 5; SNAPc subunit 5; snRNA activating protein complex 19 kDa subunit; snRNA activating protein complex subunit 5;
Immunogens
A synthesized peptide derived from human SNAPC5, corresponding to a region within the internal amino acids.
- O75971 SNPC5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLSRLQELRKEEETLLRLKAALHDQLNRLKVEELALQSMISSRRGDEMLSSHTVPEQSHDMLVHVDNEASINQTTLELSTKSHVTEEEEEEEEEESDS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. Binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box.
Nucleus.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.