LDOC1 Antibody - #DF8771
Product: | LDOC1 Antibody |
Catalog: | DF8771 |
Description: | Rabbit polyclonal antibody to LDOC1 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Horse, Dog |
Mol.Wt.: | 16 kDa; 17kD(Calculated). |
Uniprot: | O95751 |
RRID: | AB_2841975 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8771, RRID:AB_2841975.
Fold/Unfold
BCUR1; Breast cancer up regulated 1; Breast cancer upregulated 1; Gm366; Ldoc1; LDOC1_HUMAN; Leucine zipper down regulated in cancer 1; Leucine zipper protein down regulated in cancer cells; Leucine zipper protein down regulated in cancer cells; Leucine zipper protein down-regulated in cancer cells; Mar7; Mart7; Protein LDOC1; RGD1565644;
Immunogens
A synthesized peptide derived from human LDOC1, corresponding to a region within the internal amino acids.
Ubiquitously expressed with high levels in brain ant thyroid and low expression in placenta, liver and leukocytes. Expressed as well in six of the seven human breast cancer cell lines examined.
- O95751 LDOC1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQTASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDEEEEDDY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
May have an important role in the development and/or progression of some cancers.
Nucleus.
Ubiquitously expressed with high levels in brain ant thyroid and low expression in placenta, liver and leukocytes. Expressed as well in six of the seven human breast cancer cell lines examined.
Belongs to the LDOC1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.