HMG14 Antibody - #DF8777
Product: | HMG14 Antibody |
Catalog: | DF8777 |
Description: | Rabbit polyclonal antibody to HMG14 |
Application: | WB IF/ICC |
Reactivity: | Human |
Prediction: | Pig, Bovine, Horse, Dog, Chicken, Xenopus |
Mol.Wt.: | 10 kDa; 11kD(Calculated). |
Uniprot: | P05114 |
RRID: | AB_2841980 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8777, RRID:AB_2841980.
Fold/Unfold
FLJ27265; FLJ31471; High mobility group (nonhistone chromosomal) protein 14; High mobility group nucleosome binding 1; High mobility group nucleosome binding domain 1; High mobility group nucleosome binding domain containing protein 1; High mobility group nucleosome-binding domain-containing protein 1; High mobility group protein 14; HMG 14; HMG14; HMGN 1; HMGN1; HMGN1_HUMAN; MGC104230; MGC117425; Non-histone chromosomal protein HMG-14; Nonhistone chromosomal protein HMG 14; Nonhistone chromosomal protein HMG14;
Immunogens
A synthesized peptide derived from human HMG14, corresponding to a region within N-terminal amino acids.
- P05114 HMGN1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Binds to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer. May be involved in the process which maintains transcribable genes in a unique chromatin conformation. Inhibits the phosphorylation of nucleosomal histones H3 and H2A by RPS6KA5/MSK1 and RPS6KA3/RSK2 (By similarity).
Phosphorylation on Ser-21 and Ser-25 weakens binding to nucleosomes and increases the rate of H3 phosphorylation (By similarity). Phosphorylation favors cytoplasmic localization.
Nucleus. Cytoplasm.
Note: Cytoplasmic enrichment upon phosphorylation. The RNA edited version localizes to the nucleus.
Belongs to the HMGN family.
Research Fields
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.