CD52 Antibody - #DF8797
| Product: | CD52 Antibody |
| Catalog: | DF8797 |
| Description: | Rabbit polyclonal antibody to CD52 |
| Application: | WB IHC |
| Reactivity: | Human, Monkey |
| Mol.Wt.: | 7 kDa,20kDa; 7kD(Calculated). |
| Uniprot: | P31358 |
| RRID: | AB_2841995 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8797, RRID:AB_2841995.
Fold/Unfold
Cambridge pathology 1 antigen; CAMPATH 1; CAMPATH 1 antigen; CAMPATH-1 antigen; CD 52; CD52; CD52 antigen; CD52 molecule; CD52_HUMAN; CDw52; CDW52 antigen; Epididymal secretory protein E5; Epididymis secretory sperm binding protein Li 171mP; HE 5; He5; Human epididymis-specific protein 5;
Immunogens
A synthesized peptide derived from human CD52, corresponding to a region within the internal amino acids.
- P31358 CD52_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Research Backgrounds
May play a role in carrying and orienting carbohydrate, as well as having a more specific role.
Cell membrane>Lipid-anchor.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.