FHL3 Antibody - #DF8826
| Product: | FHL3 Antibody |
| Catalog: | DF8826 |
| Description: | Rabbit polyclonal antibody to FHL3 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 31 kDa; 31kD(Calculated). |
| Uniprot: | Q13643 |
| RRID: | AB_2842023 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8826, RRID:AB_2842023.
Fold/Unfold
FHL 3; FHL-3; Fhl3; FHL3_HUMAN; Four and a half LIM domains 3; Four and a half LIM domains protein 3; Skeletal muscle LIM protein 2; Skeletal muscle LIM-protein 2; SLIM-2; SLIM2;
Immunogens
A synthesized peptide derived from human FHL3, corresponding to a region within the internal amino acids.
- Q13643 FHL3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Recruited by SOX15 to FOXK1 promoters where it acts as a transcriptional coactivator of FOXK1.
Nucleus. Cytoplasm.
Expressed only in skeletal muscle.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.