PINX1 Antibody - #DF8858
| Product: | PINX1 Antibody |
| Catalog: | DF8858 |
| Description: | Rabbit polyclonal antibody to PINX1 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Rabbit |
| Mol.Wt.: | 37 kDa; 37kD(Calculated). |
| Uniprot: | Q96BK5 |
| RRID: | AB_2842055 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8858, RRID:AB_2842055.
Fold/Unfold
67-11-3 protein; FLJ20565; Hepatocellular carcinoma-related putative tumor suppressor; Liver-related putative tumor suppressor; LPTL; LPTS; MGC8850; OTTHUMP00000224984; OTTHUMP00000224985; OTTHUMP00000224986; OTTHUMP00000225053; OTTHUMP00000225054; PIN2 interacting protein 1; Pin2-interacting protein X1; PIN2/TERF1-interacting telomerase inhibitor 1; PINX1; PINX1_HUMAN; Protein 67-11-3; TRF1-interacting protein 1;
Immunogens
A synthesized peptide derived from human PINX1, corresponding to a region within the internal amino acids.
Ubiquitous; expressed at low levels. Not detectable in a number of hepatocarcinoma cell lines.
- Q96BK5 PINX1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERKRGKKRNKEATGKDVESYLQPKAKRHTEGKPERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDHVQPPEGRDFTLKPKKRRGKKKLQKPVEIAEDATLEETLVKKKKKKDSK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Microtubule-binding protein essential for faithful chromosome segregation. Mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. Inhibits telomerase activity. May inhibit cell proliferation and act as tumor suppressor.
Nucleus. Nucleus>Nucleolus. Chromosome>Telomere. Chromosome>Centromere>Kinetochore.
Note: Localizes in nucleoli, at telomere speckles and to the outer plate of kinetochores. Localization to the kinetochore is mediated by its central region and depends on NDC80 and CENPE.
Ubiquitous; expressed at low levels. Not detectable in a number of hepatocarcinoma cell lines.
The TID (telomerase inhibiting domain) domain is sufficient to bind TERT and inhibit its activity.
The TBM domain mediates interaction with TERF1.
Belongs to the PINX1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.