CHRC1 Antibody - #DF8875
| Product: | CHRC1 Antibody |
| Catalog: | DF8875 |
| Description: | Rabbit polyclonal antibody to CHRC1 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 14 kDa; 15kD(Calculated). |
| Uniprot: | Q9NRG0 |
| RRID: | AB_2842071 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8875, RRID:AB_2842071.
Fold/Unfold
CHARC1; CHARC15; CHRAC-1; CHRAC-15; Chrac1; CHRAC15; CHRC1_HUMAN; Chromatin accessibility complex 1; Chromatin accessibility complex 15 kDa protein; Chromatin accessibility complex protein 1; DNA polymerase epsilon subunit p15; histone-fold protein CHRAC15; HuCHRAC15; YCL1;
Immunogens
A synthesized peptide derived from human CHRC1, corresponding to a region within C-terminal amino acids.
Expressed in all tissues tested, including, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
- Q9NRG0 CHRC1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS
Research Backgrounds
Forms a complex with DNA polymerase epsilon subunit POLE3 and binds naked DNA, which is then incorporated into chromatin, aided by the nucleosome remodeling activity of ISWI/SNF2H and ACF1.
Nucleus.
Expressed in all tissues tested, including, heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.