KCIP1 Antibody - #DF8880
| Product: | KCIP1 Antibody |
| Catalog: | DF8880 |
| Description: | Rabbit polyclonal antibody to KCIP1 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 26 kDa; 27kD(Calculated). |
| Uniprot: | Q9NZI2 |
| RRID: | AB_2842076 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8880, RRID:AB_2842076.
Fold/Unfold
A type potassium channel modulatory protein 1; A-type potassium channel modulatory protein 1; KChIP1; KCIP1_HUMAN; Kcnip1; Kv channel interacting protein 1; Kv channel-interacting protein 1; MGC9; MGC95; Potassium channel interacting protein 1; Potassium channel-interacting protein 1; VABP; Vesicle APC binding protein; Vesicle APC-binding protein;
Immunogens
A synthesized peptide derived from human KCIP1, corresponding to a region within C-terminal amino acids.
Isoform 1 and isoform 2 are expressed in brain and kidney. Isoform 1 is also expressed in liver, pancreas, skeletal muscle, small intestine and testis. Isoform 2 is also expressed in lung, pancreas, leukocytes, prostate and thymus.
- Q9NZI2 KCIP1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQRDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM
Research Backgrounds
Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Regulates channel density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND1/Kv4.1 and KCND2/Kv4.2 currents. Increases the presence of KCND2 at the cell surface.
Cell membrane>Peripheral membrane protein. Cytoplasm. Cell projection>Dendrite.
Isoform 1 and isoform 2 are expressed in brain and kidney. Isoform 1 is also expressed in liver, pancreas, skeletal muscle, small intestine and testis. Isoform 2 is also expressed in lung, pancreas, leukocytes, prostate and thymus.
Belongs to the recoverin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.