CGGBP1 Antibody - #DF8883
Product: | CGGBP1 Antibody |
Catalog: | DF8883 |
Description: | Rabbit polyclonal antibody to CGGBP1 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 18 kDa; 19kD(Calculated). |
Uniprot: | Q9UFW8 |
RRID: | AB_2842079 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8883, RRID:AB_2842079.
Fold/Unfold
20 kDa CGG binding protein; 20 kDa CGG-binding protein; CGBP1_HUMAN; CGG binding protein 1; CGG triplet repeat binding protein 1; CGG triplet repeat-binding protein 1; CGG-binding protein 1; CGGBP 1; CGGBP; Cggbp1; OTTHUMP00000213853; OTTHUMP00000213877; p20 CGG binding protein; p20 CGGBP; p20 CGGBP DNA binding protein; p20-CGGBP DNA-binding protein;
Immunogens
A synthesized peptide derived from human CGGBP1, corresponding to a region within the internal amino acids.
Ubiquitous. Highly expressed in placenta, thymus, lymph nodes, cerebellum and cerebral cortex. Low expression in other regions of the brain.
- Q9UFW8 CGBP1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQDC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Binds to nonmethylated 5'-d(CGG)(n)-3' trinucleotide repeats in the FMR1 promoter. May play a role in regulating FMR1 promoter.
Nucleus.
Ubiquitous. Highly expressed in placenta, thymus, lymph nodes, cerebellum and cerebral cortex. Low expression in other regions of the brain.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.