TRIM35 Antibody - #DF8888
| Product: | TRIM35 Antibody |
| Catalog: | DF8888 |
| Description: | Rabbit polyclonal antibody to TRIM35 |
| Application: | WB |
| Reactivity: | Human |
| Prediction: | Rabbit, Dog |
| Mol.Wt.: | 57 kDa; 57kD(Calculated). |
| Uniprot: | Q9UPQ4 |
| RRID: | AB_2842084 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8888, RRID:AB_2842084.
Fold/Unfold
0710005M05Rik; A430106H13Rik; AW046487; Hemopoietic lineage switch protein 5; HLS5; KIAA1098; Macrophage derived apoptosis inducing RBCC protein; MAIR; MGC17233; mKIAA1098; NC8; Protein MAIR; Protein Nc8; TRI35_HUMAN; TRIM35; Tripartite motif containing 35; Tripartite motif containing protein 35; Tripartite motif-containing protein 35;
Immunogens
A synthesized peptide derived from human TRIM35, corresponding to a region within N-terminal amino acids.
- Q9UPQ4 TRI35_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MERSPDVSPGPSRSFKEELLCAVCYDPFRDAVTLRCGHNFCRGCVSRCWEVQVSPTCPVCKDRASPADLRTNHTLNNLVEKLLREEAEGARWTSYRFSRVCRLHRGQLSLFCLEDKELLCCSCQADPRHQGHRVQPVKDTAHDFRAKCRNMEHALREKAKAFWAMRRSYEAIAKHNQVEAAWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMKQLTEETEVLAHEIERLQMEMKEDDVSFLMKHKSRKRRLFCTMEPEPVQPGMLIDVCKYLGSLQYRVWKKMLASVESVPFSFDPNTAAGWLSVSDDLTSVTNHGYRVQVENPERFSSAPCLLGSRVFSQGSHAWEVALGGLQSWRVGVVRVRQDSGAEGHSHSCYHDTRSGFWYVCRTQGVEGDHCVTSDPATSPLVLAIPRRLRVELECEEGELSFYDAERHCHLYTFHARFGEVRPYFYLGGARGAGPPEPLRICPLHISVKEELDG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Reduces FGFR1-dependent tyrosine phosphorylation of PKM, inhibiting PKM-dependent lactate production, glucose metabolism, and cell growth. Involved in the cell death mechanism (By similarity).
Cytoplasm. Nucleus.
Note: Found predominantly in cytoplasm with a granular distribution. Found in punctuate nuclear bodies (By similarity).
The RING finger domain and the coiled-coil region are required for the apoptosis-inducing activity.
Belongs to the TRIM/RBCC family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.