FGFBP3 Antibody - #DF8950
Product: | FGFBP3 Antibody |
Catalog: | DF8950 |
Description: | Rabbit polyclonal antibody to FGFBP3 |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 28,60 kDa; 28kD(Calculated). |
Uniprot: | Q8TAT2 |
RRID: | AB_2842146 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8950, RRID:AB_2842146.
Fold/Unfold
C10orf13; FGF-binding protein 3; FGF-BP3; FGFBP-3; Fgfbp3; FGFP3_HUMAN; Fibroblast growth factor-binding protein 3;
Immunogens
- Q8TAT2 FGFP3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTPPKLRASLSPSLLLLLSGCLLAAARREKGAASNVAEPVPGPTGGSSGRFLSPEQHACSWQLLLPAPEAAAGSELALRCQSPDGARHQCAYRGHPERCAAYAARRAHFWKQVLGGLRKKRRPCHDPAPLQARLCAGKKGHGAELRLVPRASPPARPTVAGFAGESKPRARNRGRTRERASGPAAGTPPPQSAPPKENPSERKTNEGKRKAALVPNEERPMGTGPDPDGLDGNAELTETYCAEKWHSLCNFFVNFWNG
PTMs - Q8TAT2 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S152 | Phosphorylation | Uniprot | |
T158 | O-Glycosylation | Uniprot | |
T158 | Phosphorylation | Uniprot | |
S166 | Phosphorylation | Uniprot | |
S200 | Phosphorylation | Uniprot |
Research Backgrounds
Heparin-binding protein which binds to FGF2, prevents binding of FGF2 to heparin and probably inhibits immobilization of FGF2 on extracellular matrix glycosaminoglycans, allowing its release and subsequent activation of FGFR signaling which leads to increased vascular permeability.
Secreted.
Interacts with FGF2.
Belongs to the fibroblast growth factor-binding protein family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.