IGFBP6 Antibody - #DF8959
| Product: | IGFBP6 Antibody |
| Catalog: | DF8959 |
| Description: | Rabbit polyclonal antibody to IGFBP6 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 25 kDa; 25kD(Calculated). |
| Uniprot: | P24592 |
| RRID: | AB_2842155 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8959, RRID:AB_2842155.
Fold/Unfold
IBP 6; IBP-6; IBP6; IBP6_HUMAN; IGF binding protein 6; IGF-binding protein 6; IGFBP 6; IGFBP-6; IGFBP6; Insulin like growth factor binding protein 6; Insulin-like growth factor-binding protein 6;
Immunogens
- P24592 IBP6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P24592 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S52 | Phosphorylation | Uniprot | |
| S120 | O-Glycosylation | Uniprot | |
| T126 | O-Glycosylation | Uniprot | |
| S144 | Phosphorylation | Uniprot | |
| T176 | O-Glycosylation | Uniprot | |
| Y179 | Phosphorylation | Uniprot | |
| T184 | O-Glycosylation | Uniprot | |
| Y196 | Phosphorylation | Uniprot | |
| S204 | O-Glycosylation | Uniprot | |
| S204 | Phosphorylation | Uniprot | |
| S221 | Phosphorylation | Uniprot | |
| S225 | Phosphorylation | Uniprot | |
| S231 | Phosphorylation | Uniprot | |
| S233 | Phosphorylation | Uniprot |
Research Backgrounds
IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
O-linked glycans consist of hexose (probably Gal), N-acetylhexosamine (probably GalNAc) and sialic acid residues. O-glycosylated with core 1 or possibly core 8 glycans. O-glycosylated on one site only in the region AA 143-168 in cerebrospinal fluid.
Secreted.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.