IL3 Antibody - #DF8985
| Product: | IL3 Antibody |
| Catalog: | DF8985 |
| Description: | Rabbit polyclonal antibody to IL3 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Rat |
| Mol.Wt.: | 17 kDa; 17kD(Calculated). |
| Uniprot: | P08700 |
| RRID: | AB_2842181 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8985, RRID:AB_2842181.
Fold/Unfold
Colony stimulating factor multiple; Hematopoietic growth factor; IL 3; IL-3; IL3; IL3_HUMAN; Interleukin 3 (colony stimulating factor, multiple); Interleukin 3; Interleukin-3; Mast cell growth factor; MCGF; MGC79398; MGC79399; Multi CSF; Multilineage colony stimulating factor; Multipotential colony stimulating factor; Multipotential colony-stimulating factor; OTTHUMP00000065963; P cell stimulating factor; P-cell-stimulating factor;
Immunogens
A synthesized peptide derived from human IL3, corresponding to a region within the internal amino acids.
- P08700 IL3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Research Backgrounds
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.
This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.
Secreted.
Activated T-cells, mast cells, natural killer cells.
Belongs to the IL-3 family.
Research Fields
· Cellular Processes > Cell growth and death > Apoptosis. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
· Human Diseases > Cancers: Specific types > Acute myeloid leukemia. (View pathway)
· Human Diseases > Immune diseases > Asthma.
· Organismal Systems > Immune system > Hematopoietic cell lineage. (View pathway)
· Organismal Systems > Immune system > Fc epsilon RI signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.