IL31 Antibody - #DF8986
| Product: | IL31 Antibody |
| Catalog: | DF8986 |
| Description: | Rabbit polyclonal antibody to IL31 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 18 kDa, 37 kDa; 18kD(Calculated). |
| Uniprot: | Q6EBC2 |
| RRID: | AB_2842182 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8986, RRID:AB_2842182.
Fold/Unfold
IL 31; IL-31; IL31; IL31_HUMAN; Interleukin 31; Interleukin-31;
Immunogens
A synthesized peptide derived from human IL31, corresponding to a region within the internal amino acids.
Detected at low levels in testis, bone marrow, skeletal muscle, kidney, colon, thymus, small intestine and trachea.
- Q6EBC2 IL31_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASHSGPSTSVLFLFCCLGGWLASHTLPVRLLRPSDDVQKIVEELQSLSKMLLKDVEEEKGVLVSQNYTLPCLSPDAQPPNNIHSPAIRAYLKTIRQLDNKSVIDEIIEHLDKLIFQDAPETNISVPTDTHECKRFILTISQQFSECMDLALKSLTSGAQQATT
Research Backgrounds
Activates STAT3 and possibly STAT1 and STAT5 through the IL31 heterodimeric receptor composed of IL31RA and OSMR. May function in skin immunity. Enhances myeloid progenitor cell survival in vitro (By similarity). Induces RETNLA and serum amyloid A protein expression in macrophages (By similarity).
Secreted.
Detected at low levels in testis, bone marrow, skeletal muscle, kidney, colon, thymus, small intestine and trachea.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.