IFI27 Antibody - #DF8989
| Product: | IFI27 Antibody |
| Catalog: | DF8989 |
| Description: | Rabbit polyclonal antibody to IFI27 |
| Application: | WB IHC |
| Reactivity: | Human |
| Mol.Wt.: | 11 kDa; 12kD(Calculated). |
| Uniprot: | P40305 |
| RRID: | AB_2842185 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8989, RRID:AB_2842185.
Fold/Unfold
2310061N23Rik; FAM 14D; FAM14D; IFI 27; IFI27; IFI27_HUMAN; Interferon alpha induced 11.5 kDa protein; Interferon alpha inducible protein 27; Interferon alpha-induced 11.5 kDa protein; Interferon alpha-inducible protein 27; interferon alpha-inducible protein 27, mitochondrial; Interferon inducible protein 27; interferon-stimulated gene 12; Interferon-stimulated gene 12a protein; ISG 12; ISG12; ISG12(a); ISG12(a) protein; ISG12A; mitochondrial; p27;
Immunogens
- P40305 IFI27_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAMAAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY
PTMs - P40305 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T7 | Phosphorylation | Uniprot | |
| S8 | Phosphorylation | Uniprot | |
| S24 | Phosphorylation | Uniprot |
Research Backgrounds
Probable adapter protein involved in different biological processes. Part of the signaling pathways that lead to apoptosis. Involved in type-I interferon-induced apoptosis characterized by a rapid and robust release of cytochrome C from the mitochondria and activation of BAX and caspases 2, 3, 6, 8 and 9. Also functions in TNFSF10-induced apoptosis. May also have a function in the nucleus, where it may be involved in the interferon-induced negative regulation of the transcriptional activity of NR4A1, NR4A2 and NR4A3 through the enhancement of XPO1-mediated nuclear export of these nuclear receptors. May thereby play a role in the vascular response to injury (By similarity). In the innate immune response, has an antiviral activity towards hepatitis C virus/HCV. May prevent the replication of the virus by recruiting both the hepatitis C virus non-structural protein 5A/NS5A and the ubiquitination machinery via SKP2, promoting the ubiquitin-mediated proteasomal degradation of NS5A.
Mitochondrion membrane>Multi-pass membrane protein. Nucleus inner membrane>Multi-pass membrane protein. Endoplasmic reticulum membrane>Multi-pass membrane protein.
Note: Exclusive localizations in either the nucleus or the mitochondrion have been reported.
Homodimer. Interacts with hepatitis C virus/HCV non-structural protein NS5A; promotes the ubiquitin-mediated proteasomal degradation of NS5A. Interacts with SKP2; promotes the ubiquitin-mediated proteasomal degradation of NS5A. Interacts with NR4A1. May interact with BCL2.
Belongs to the IFI6/IFI27 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.