IFI27 Antibody - #DF8989

(3)   (6)  
Product: IFI27 Antibody
Catalog: DF8989
Description: Rabbit polyclonal antibody to IFI27
Application: WB IHC
Cited expt.: WB, IHC
Reactivity: Human
Mol.Wt.: 11 kDa; 12kD(Calculated).
Uniprot: P40305
RRID: AB_2842185

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
IFI27 Antibody detects endogenous levels of total IFI27.
RRID:
AB_2842185
Cite Format: Affinity Biosciences Cat# DF8989, RRID:AB_2842185.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

2310061N23Rik; FAM 14D; FAM14D; IFI 27; IFI27; IFI27_HUMAN; Interferon alpha induced 11.5 kDa protein; Interferon alpha inducible protein 27; Interferon alpha-induced 11.5 kDa protein; Interferon alpha-inducible protein 27; interferon alpha-inducible protein 27, mitochondrial; Interferon inducible protein 27; interferon-stimulated gene 12; Interferon-stimulated gene 12a protein; ISG 12; ISG12; ISG12(a); ISG12(a) protein; ISG12A; mitochondrial; p27;

Immunogens

Immunogen:

A synthesized peptide derived from human IFI27, corresponding to a region within N-terminal amino acids.

Uniprot:

P40305(IFI27_HUMAN) >>Visit HPA database.

Gene(ID):
IFI27(3429)
Sequence:
MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAMAAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY

Research Backgrounds

Function:

Probable adapter protein involved in different biological processes. Part of the signaling pathways that lead to apoptosis. Involved in type-I interferon-induced apoptosis characterized by a rapid and robust release of cytochrome C from the mitochondria and activation of BAX and caspases 2, 3, 6, 8 and 9. Also functions in TNFSF10-induced apoptosis. May also have a function in the nucleus, where it may be involved in the interferon-induced negative regulation of the transcriptional activity of NR4A1, NR4A2 and NR4A3 through the enhancement of XPO1-mediated nuclear export of these nuclear receptors. May thereby play a role in the vascular response to injury (By similarity). In the innate immune response, has an antiviral activity towards hepatitis C virus/HCV. May prevent the replication of the virus by recruiting both the hepatitis C virus non-structural protein 5A/NS5A and the ubiquitination machinery via SKP2, promoting the ubiquitin-mediated proteasomal degradation of NS5A.

Subcellular Location:

Mitochondrion membrane>Multi-pass membrane protein. Nucleus inner membrane>Multi-pass membrane protein. Endoplasmic reticulum membrane>Multi-pass membrane protein.
Note: Exclusive localizations in either the nucleus or the mitochondrion have been reported.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Family&Domains:

Belongs to the IFI6/IFI27 family.

References

1). Single cell-spatial transcriptomics and bulk multi-omics analysis of heterogeneity and ecosystems in hepatocellular carcinoma. NPJ precision oncology, 2024 (PubMed: 39548284) [IF=7.9]

Application: IHC    Species: human    Sample: HCC cells

Fig. 3: Spatiotemporal intratumor heterogeneities in HCC and cirrhosis. a UMAP plot showing the HCC and CIR cell types, with different color-codes denoting lesions origin (left) and cell subclusters (right). b, c UMAP plot and spatial feature plots showing the distribution of specific markers on the cell subclusters from Fig. 2A (right). d Immunohistochemical validation of the expression of specific markers, the scale bars represent 20 μm. e Heatmap representing the average expression of specific markers of each cell subcluster at the full-length transcriptome, whole transcriptome, proteome, and scRNA levels. f Heatmap representing the levels of metabolic changes in the tissues and blood of HCC patients and control donor. See also Supplementary Table 1.
2). Integrated Bioinformatics and Validation Reveal IFI27 and Its Related Molecules as Potential Identifying Genes in Liver Cirrhosis. Biomolecules, 2023 (PubMed: 38275754) [IF=5.5]

Application: WB    Species: Mouse    Sample: Liver tissue

Figure 8. (A–C) Representative H&E staining, Masson staining and Sirius red staining of mice in the control group and the TAA group, scale: 100 µm. (D) Liver tissue immunofluorescence shows co-localization of IFI27 and liver macrophages. (E,F) The expression of COX7A1 and IFI27 in liver tissue and macrophages. (G) After treatment with si-IFI27, the knockdown efficiency was detected using RT-PCR. (H) ELISA was used to detect the concentration of IL-1β and TNF-α secreted from RAW264.7 in the different groups. (I–M) mRNA expression of M1 markers (CD80, CD86, iNOs) and pro-inflammation factors (IL-1β and TNF-α) in three groups were assayed using RT-qPCR. Data are presented as means ± SEM. * p < 0.05; ** p < 0.01; *** p < 0.001; **** p < 0.0001; ns, not significant. COX7A1, cytochrome c oxidase subunit 7A1; IFI27, interferon alpha-inducible protein 27; IL-1β, interleukin-1 beta; TNF-α, tumor necrosis factor alpha. (N) ROS generation level of RAW264.7 cells after LPS and si-IFI27 intervention (scale bar: 200 μm). (O) Quantification of ROS-positive area.
3). Prognostic value of IFI27 in HNSCC and functional analysis under ALKBH5 regulation. Scientific reports, 2025 (PubMed: 39994291) [IF=3.8]

Application: IHC    Species: human    Sample: HNSCC

Fig. 3 Expression of IFI27 in HNSCC. (A) IHC staining of IFI27 in HNSCC (10 × 20). (B) IHC staining of IFI27 in HNSCC (10 × 40). (C) Differential expression of IFI27 in HNSCC and adjacent normal tissues (P 

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.