MAGEA10 Antibody - #DF9015
Product: | MAGEA10 Antibody |
Catalog: | DF9015 |
Description: | Rabbit polyclonal antibody to MAGEA10 |
Application: | WB |
Reactivity: | Human, Mouse |
Prediction: | Sheep |
Mol.Wt.: | 41 kDa; 41kD(Calculated). |
Uniprot: | P43363 |
RRID: | AB_2842211 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9015, RRID:AB_2842211.
Fold/Unfold
Cancer/testis antigen 1.10; cancer/testis antigen family 1, member 10; CT1.10; MAGE 10 antigen; MAGE10; Melanoma antigen family A 10; Melanoma associated antigen 10;
Immunogens
Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for spermatogonia, spermatocytes and placenta.
- P43363 MAGAA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPSSFPSSSSSSSSSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQMKEPITKAEILESVIRNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLTYDGMLSDVQSMPKTGILILILSIVFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGPRAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P43363 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S56 | Phosphorylation | Uniprot | |
S57 | Phosphorylation | Uniprot | |
S58 | Phosphorylation | Uniprot | |
S59 | Phosphorylation | Uniprot | |
S116 | Phosphorylation | Uniprot | |
T119 | Phosphorylation | Uniprot | |
K269 | Ubiquitination | Uniprot | |
Y280 | Phosphorylation | Uniprot | |
K313 | Ubiquitination | Uniprot | |
K317 | Ubiquitination | Uniprot |
Research Backgrounds
Not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression.
Nucleus.
Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for spermatogonia, spermatocytes and placenta.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.