ROBLD3 Antibody - #DF9021
| Product: | ROBLD3 Antibody |
| Catalog: | DF9021 |
| Description: | Rabbit polyclonal antibody to ROBLD3 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 14 kDa; 14kD(Calculated). |
| Uniprot: | Q9Y2Q5 |
| RRID: | AB_2842217 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9021, RRID:AB_2842217.
Fold/Unfold
ENDAP; Endosomal adaptor protein p14; HSPC003; LAMTOR2; Late endosomal/lysosomal adaptor and MAPK and MTOR activator 2; Late endosomal/lysosomal Mp1 interacting protein; Late endosomal/lysosomal Mp1-interacting protein; LTOR2_HUMAN; MAPBPIP; MAPKSP1 adaptor protein; MAPKSP1AP; Mitogen activated protein binding protein interacting protein; Mitogen-activated protein-binding protein-interacting protein; p14; Ragulator complex protein LAMTOR2; Ragulator2; Roadblock domain containing 3; Roadblock domain containing protein 3; Roadblock domain-containing protein 3; ROBLD 3; RP11 336K24.9;
Immunogens
A synthesized peptide derived from human ROBLD3, corresponding to a region within the internal amino acids.
- Q9Y2Q5 LTOR2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2.
Late endosome membrane>Peripheral membrane protein>Cytoplasmic side. Lysosome membrane>Peripheral membrane protein>Cytoplasmic side.
Belongs to the GAMAD family.
Research Fields
· Environmental Information Processing > Signal transduction > mTOR signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.