CENPP Antibody - #DF9060
Product: | CENPP Antibody |
Catalog: | DF9060 |
Description: | Rabbit polyclonal antibody to CENPP |
Application: | WB |
Reactivity: | Human |
Mol.Wt.: | 33 kDa; 33kD(Calculated). |
Uniprot: | Q6IPU0 |
RRID: | AB_2842256 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9060, RRID:AB_2842256.
Fold/Unfold
CENP P; CENP-P; cenpp; CENPP_HUMAN; Centromere protein P; FLJ33928; RP11-19J3.3;
Immunogens
- Q6IPU0 CENPP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDAELAEVRALQAEIAALRRACEDPPAPWEEKSRVQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQTEDLTSTEMTEKSIRKVLQRHRLSGNCHMVTFQLEFQILEIQNKERLSSAVTDLNIIMEPTECSELSEFVSRAEERKDLFMFFRSLHFFVEWFEYRKRTFKHLKEKYPDAVYLSEGPSSCSMGIRSASRPGFELVIVWRIQIDEDGKVFPKLDLLTKVPQRALELDKNRAIETAPLSFRTLVGLLGIEAALESLIKSLCAEENN
PTMs - Q6IPU0 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K32 | Ubiquitination | Uniprot | |
K37 | Ubiquitination | Uniprot | |
S38 | Phosphorylation | Uniprot | |
K83 | Ubiquitination | Uniprot | |
T85 | Phosphorylation | Uniprot | |
T89 | Phosphorylation | Uniprot | |
T94 | Phosphorylation | Uniprot | |
K96 | Ubiquitination | Uniprot | |
K241 | Ubiquitination | Uniprot | |
K251 | Ubiquitination | Uniprot | |
T257 | Phosphorylation | Uniprot | |
S261 | Phosphorylation | Uniprot |
Research Backgrounds
Component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.
Nucleus. Chromosome>Centromere.
Note: Localizes exclusively in the centromeres. The CENPA-CAD complex is probably recruited on centromeres by the CENPA-NAC complex.
Component of the CENPA-CAD complex, composed of CENPI, CENPK, CENPL, CENPO, CENPP, CENPQ, CENPR and CENPS. The CENPA-CAD complex interacts with the CENPA-NAC complex, at least composed of CENPA, CENPC, CENPH, CENPM, CENPN, CENPT and CENPU.
Belongs to the CENP-P/CTF19 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.