MYCNOS Antibody - #DF9068
Product: | MYCNOS Antibody |
Catalog: | DF9068 |
Description: | Rabbit polyclonal antibody to MYCNOS |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 12 kDa; 12kD(Calculated). |
Uniprot: | P40205 |
RRID: | AB_2842264 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9068, RRID:AB_2842264.
Immunogens
A synthesized peptide derived from human MYCNOS, corresponding to a region within C-terminal amino acids.
Expressed in the neuronal cells of the cerebrum and cerebellum, spermatocytes of the testis, pancreatic cells and also the heart. Expressed in both primary and metastatic neuroblastomas and in thyroid tumors (at protein level). Expression is associated with poor prognosis in neuroblastoma. Expressed in the fetal brain, lung, liver and kidney at varying low levels.
- P40205 NCYM_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQHPPCEPGNCLSLKEKKITEGSGGVCWGGETDASNPAPALTACCAAEREANVEQGLAGRLLLCNYERRVVRRCKIAGRGRAPLGTRPLDVSSFKLKEEGRPPCLKINK
Research Backgrounds
Regulates stability of MYCN in neuroblastoma cells by inhibiting GSK3B-mediated MYCN phosphorylation. Inhibits GSK3B activity by promoting its phosphorylation at 'Ser-9'.
Cytoplasm. Nucleus.
Expressed in the neuronal cells of the cerebrum and cerebellum, spermatocytes of the testis, pancreatic cells and also the heart. Expressed in both primary and metastatic neuroblastomas and in thyroid tumors (at protein level). Expression is associated with poor prognosis in neuroblastoma. Expressed in the fetal brain, lung, liver and kidney at varying low levels.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.