GOLT1B Antibody - #DF9071

Product: | GOLT1B Antibody |
Catalog: | DF9071 |
Description: | Rabbit polyclonal antibody to GOLT1B |
Application: | WB IHC |
Cited expt.: | WB, IHC |
Reactivity: | Human, Mouse, Rat, Monkey |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Chicken, Xenopus |
Mol.Wt.: | 15 kDa; 15kD(Calculated). |
Uniprot: | Q9Y3E0 |
RRID: | AB_2842267 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9071, RRID:AB_2842267.
Fold/Unfold
CGI-141; GCT2; Germ cell tumor 2; Golgi transport 1 homolog B; Golgi transport 1B; GOLT1B; GOT1; GOT1B_HUMAN; hGOT1a; Putative NF-kappa-B-activating protein 470; Vesicle transport protein GOT1B; YMR292W;
Immunogens
A synthesized peptide derived from human GOLT1B, corresponding to a region within C-terminal amino acids.
Widely expressed. Tends to be up-regulated in seminomas compared to normal testis.
- Q9Y3E0 GOT1B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MISLTDTQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNVLFVAGLAFVIGLERTFRFFFQKHKMKATGFFLGGVFVVLIGWPLIGMIFEIYGFFLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDKVGESNNMV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
May be involved in fusion of ER-derived transport vesicles with the Golgi complex.
Golgi apparatus membrane>Multi-pass membrane protein.
Widely expressed. Tends to be up-regulated in seminomas compared to normal testis.
Belongs to the GOT1 family.
References
Application: WB Species: Mice Sample: HCT116 and RKO cells
Application: IHC Species: Mice Sample: HCT116 cells
Application: IF/ICC Species: Mice Sample: HCT116 cells
Application: WB Species: human Sample: HCT116 and RKO cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.