MRPS18B Antibody - #DF9096
Product: | MRPS18B Antibody |
Catalog: | DF9096 |
Description: | Rabbit polyclonal antibody to MRPS18B |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 29kDa; 29kD(Calculated). |
Uniprot: | Q9Y676 |
RRID: | AB_2842292 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9096, RRID:AB_2842292.
Fold/Unfold
28S ribosomal protein S18-2; 28S ribosomal protein S18b; 28S ribosomal protein S18b, mitochondrial; C6orf14; DKFZp564H0223; HSPC 183; HSPC183; mitochondrial; Mitochondrial ribosomal protein S18 2; Mitochondrial ribosomal protein S18B; MRP S18 2; MRP S18 b; MRP S18b; MRP-S18-2; MRP-S18-b; MRPS 18B; MRPS18 2; Mrps18-b; MRPS18B; PTD017; RT18B_HUMAN; S18amt; S18mt-b;
Immunogens
A synthesized peptide derived from human MRPS18B, corresponding to a region within the internal amino acids.
- Q9Y676 RT18B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Mitochondrion.
Belongs to the bacterial ribosomal protein bS18 family. Mitochondrion-specific ribosomal protein mS40 subfamily.
Research Fields
· Human Diseases > Cancers: Overview > Viral carcinogenesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.