NIP7 Antibody - #DF9138
| Product: | NIP7 Antibody |
| Catalog: | DF9138 |
| Description: | Rabbit polyclonal antibody to NIP7 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 20 kDa; 20kD(Calculated). |
| Uniprot: | Q9Y221 |
| RRID: | AB_2842334 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9138, RRID:AB_2842334.
Fold/Unfold
60S ribosome subunit biogenesis protein NIP7 homolog; CGI 37; CGI37; FLJ10296; HSPC031; HSPC180; KD93; NIP 7; NIP7; NIP7 nucleolar pre rRNA processing protein; NIP7_HUMAN; Nuclear import 7; Nuclear import 7 homolog (S. cerevisiae); Nuclear import 7 homolog; OK/SW cl.76; OK/SW cl.78; OTTHUMP00000174889;
Immunogens
- Q9Y221 NIP7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y221 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T5 | Phosphorylation | Uniprot | |
| T9 | Phosphorylation | Uniprot | |
| K15 | Ubiquitination | Uniprot | |
| R30 | Methylation | Uniprot | |
| R43 | Methylation | Uniprot | |
| K50 | Ubiquitination | Uniprot | |
| K53 | Ubiquitination | Uniprot | |
| K62 | Ubiquitination | Uniprot | |
| K72 | Acetylation | Uniprot | |
| K72 | Ubiquitination | Uniprot | |
| Y88 | Phosphorylation | Uniprot | |
| K94 | Ubiquitination | Uniprot | |
| K96 | Ubiquitination | Uniprot | |
| K100 | Ubiquitination | Uniprot | |
| K115 | Ubiquitination | Uniprot | |
| K148 | Ubiquitination | Uniprot | |
| K155 | Ubiquitination | Uniprot |
Research Backgrounds
Required for proper 34S pre-rRNA processing and 60S ribosome subunit assembly.
Nucleus>Nucleolus.
Expressed in hematopoietic stem/progenitor cells.
Monomer. Interacts with pre-ribosome complex. May bind to RNA (By similarity). Interacts with NOL8. May interact with SBDS. Interacts with FTSJ3.
Belongs to the NIP7 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.