Product: ADAMDEC1 Antibody
Catalog: DF9167
Description: Rabbit polyclonal antibody to ADAMDEC1
Application: WB IHC IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse
Mol.Wt.: 53kDa; 53kD(Calculated).
Uniprot: O15204
RRID: AB_2842363

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:1000-3000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse
Clonality:
Polyclonal
Specificity:
ADAMDEC1 Antibody detects endogenous levels of total ADAMDEC1.
RRID:
AB_2842363
Cite Format: Affinity Biosciences Cat# DF9167, RRID:AB_2842363.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

A disintegrin and metalloproteinase domain like protein decysin 1; A disintegrin and metalloproteinase domain-like protein decysin-1; ADAM DEC1; ADAM like decysin 1; ADAM like protein decysin 1; ADAM-like protein decysin-1; ADAMDEC 1; Adamdec1; ADEC1_HUMAN; Decysin; Disintegrin protease; M12.219;

Immunogens

Immunogen:

A synthesized peptide derived from human ADAMDEC1, corresponding to a region within C-terminal amino acids.

Uniprot:
Gene(ID):
Expression:
O15204 ADEC1_HUMAN:

Expressed highly in the small intestine and appendix, moderately in lymph node, mucosal lining of the colon, thymus, spleen and very weakly in the bone marrow. Predominantly expressed in dendritic cells (DC) of the germinal center. Weakly expressed in monocyte and highly expressed in macrophage. Absent in immature DC.

Sequence:
MLRGISQLPAVATMSWVLLPVLWLIVQTQAIAIKQTPELTLHEIVCPKKLHILHKREIKNNQTEKHGKEERYEPEVQYQMILNGEEIILSLQKTKHLLGPDYTETLYSPRGEEITTKPENMEHCYYKGNILNEKNSVASISTCDGLRGYFTHHHQRYQIKPLKSTDEKEHAVFTSNQEEQDPANHTCGVKSTDGKQGPIRISRSLKSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTLIRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGKKIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE

Research Backgrounds

Function:

May play an important role in the control of the immune response and during pregnancy.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed highly in the small intestine and appendix, moderately in lymph node, mucosal lining of the colon, thymus, spleen and very weakly in the bone marrow. Predominantly expressed in dendritic cells (DC) of the germinal center. Weakly expressed in monocyte and highly expressed in macrophage. Absent in immature DC.

References

1). ADAMDEC1 promotes skin inflammation in rosacea via modulating the polarization of M1 macrophages. BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, 2020 (PubMed: 31627897) [IF=2.5]

Application: IF/ICC    Species: mouse    Sample: macrophages

Fig. 2. ADAMDEC1 was located at macrophages and upregulated in M1 macrophages. (A) Co-localization of F4/80 and ADAMDEC1 in sections from LL37-induced mice model.

Application: WB    Species: mouse    Sample: macrophages

Fig. 3. |Knocking down of ADAMDEC1 impeded M1 macrophage activation. Macrophages were transfected with ADAMDEC1 siRNA (siAdam-1 and siAdam-2) (n ¼ 3) and negative control siRNA (siCtrl) (n ¼ 3) separately for 48 h. (A) ADAMDEC1 protein and mRNA level were detected in transfected human monocyte-derived macrophages.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.