APOL3 Antibody - #DF9217
| Product: | APOL3 Antibody |
| Catalog: | DF9217 |
| Description: | Rabbit polyclonal antibody to APOL3 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 44 kDa; 44kD(Calculated). |
| Uniprot: | O95236 |
| RRID: | AB_2842413 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9217, RRID:AB_2842413.
Fold/Unfold
ApoL III; ApoL-III; APOL3; APOL3_HUMAN; APOLIII; Apolipoprotein L 3; Apolipoprotein L III; Apolipoprotein L-III; Apolipoprotein L3; Apolipoprotein LIII; CG12 1; CG12_1; CG121; TNF inducible protein CG12 1; TNF-inducible protein CG12-1;
Immunogens
A synthesized peptide derived from human APOL3, corresponding to a region within N-terminal amino acids.
Widely expressed; the highest levels are in prostate, lung and placenta; also detected in kidney, bone marrow, spleen, thymus, spinal cord, adrenal gland, salivary gland, trachea and mammary gland; levels are low in brain, heart, fetal liver, pancreas and testis.
- O95236 APOL3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGLGQGWGWEASCFACLIRSCCQVVTFTFPFGFQGISQSLENVSGYYADARLEVGSTQLRTAGSCSHSFKRSFLEKKRFTEEATKYFRERVSPVHLQILLTNNEAWKRFVTAAELPRDEADALYEALKKLRTYAAIEDEYVQQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEVHRGCTISNVVSSSTGAASGIMSLAGLVLAPFTAGTSLALTAAGVGLGAASAVTGITTSIVEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSLLNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRGARILSATTSGIFLALDVVNLVYESKHLHEGAKSASAEELRRQAQELEENLMELTQIYQRLNPCHTH
Research Backgrounds
May affect the movement of lipids in the cytoplasm or allow the binding of lipids to organelles.
Cytoplasm.
Widely expressed; the highest levels are in prostate, lung and placenta; also detected in kidney, bone marrow, spleen, thymus, spinal cord, adrenal gland, salivary gland, trachea and mammary gland; levels are low in brain, heart, fetal liver, pancreas and testis.
Belongs to the apolipoprotein L family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.