BCL2L14 Antibody - #DF9220
Product: | BCL2L14 Antibody |
Catalog: | DF9220 |
Description: | Rabbit polyclonal antibody to BCL2L14 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Prediction: | Bovine, Sheep |
Mol.Wt.: | 37 kDa; 37kD(Calculated). |
Uniprot: | Q9BZR8 |
RRID: | AB_2842416 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9220, RRID:AB_2842416.
Fold/Unfold
Apoptosis facilitator Bcl 2 like protein 14; Apoptosis regulator BCL G; Bcl2 L 14; BCL2 like 14 (apoptosis facilitator); BCL2 like 14; BCL2L14; BCLG; testicular tissue protein Li 26;
Immunogens
A synthesized peptide derived from human BCL2L14, corresponding to a region within N-terminal amino acids.
- Q9BZR8 B2L14_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Plays a role in apoptosis.
Phosphorylated by MELK, leading to inhibit its pro-apoptotic function.
Cytoplasm.
Cytoplasm>Cytosol.
Note: Diffusely distributed throughout the cytosol.
Endomembrane system.
Note: Predominantly localized to cytosolic organelles.
Isoform 1 is widely expressed. Isoform 2 is testis-specific.
Belongs to the Bcl-2 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.