AQP10 Antibody - #DF9221
| Product: | AQP10 Antibody |
| Catalog: | DF9221 |
| Description: | Rabbit polyclonal antibody to AQP10 |
| Application: | WB IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Rabbit, Chicken |
| Mol.Wt.: | 32 kDa; 32kD(Calculated). |
| Uniprot: | Q96PS8 |
| RRID: | AB_2842417 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9221, RRID:AB_2842417.
Fold/Unfold
AQP 10; AQP-10; AQP10; AQP10_HUMAN; AQPA Human; Aquaglyceroporin-10; Aquaporin-10; Aquaporin10; Small intestine aquaporin;
Immunogens
Detected in epithelial cells on villi in the ileum, and also in stomach, jejunum, colon, rectum, white adipose tissue and placenta (at protein level) (PubMed:15221416, PubMed:23382902). Expressed in duodenum and jejunum. Highest expression in absorptive epithelial cells at the tips of villi in the jejunum (PubMed:11573934, PubMed:12084581). Detected in subcutaneous adipose tissue (PubMed:23382902).
- Q96PS8 AQP10_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVFTQAPAEIMGHLRIRSLLARQCLAEFLGVFVLMLLTQGAVAQAVTSGETKGNFFTMFLAGSLAVTIAIYVGGNVSGAHLNPAFSLAMCIVGRLPWVKLPIYILVQLLSAFCASGATYVLYHDALQNYTGGNLTVTGPKETASIFATYPAPYLSLNNGFLDQVLGTGMLIVGLLAILDRRNKGVPAGLEPVVVGMLILALGLSMGANCGIPLNPARDLGPRLFTYVAGWGPEVFSAGNGWWWVPVVAPLVGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECKL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96PS8 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| N133 | N-Glycosylation | Uniprot |
Research Backgrounds
Water channel that mediates water transport across cell membranes irrespective of the cytosolic pH. The channel is permeable to glycerol, especially when the cytosolic pH is acidified. Contributes to adipocyte water and glycerol permeability, and may thereby contribute to the utilization of glycerol derived from phospholipid degradation. May contribute to water transport in the intestine (Probable).
Water channel that mediates water transport across cell membranes, but that is not permeable to glycerol.
Apical cell membrane>Multi-pass membrane protein. Cell membrane>Multi-pass membrane protein. Lipid droplet.
Note: Detected around lipid droplets.
Detected in epithelial cells on villi in the ileum, and also in stomach, jejunum, colon, rectum, white adipose tissue and placenta (at protein level). Expressed in duodenum and jejunum. Highest expression in absorptive epithelial cells at the tips of villi in the jejunum. Detected in subcutaneous adipose tissue.
Homotetramer.
Aquaporins contain two tandem repeats each containing three membrane-spanning domains and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA).
Belongs to the MIP/aquaporin (TC 1.A.8) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.