CTAG2 Antibody - #DF9326
| Product: | CTAG2 Antibody |
| Catalog: | DF9326 |
| Description: | Rabbit polyclonal antibody to CTAG2 |
| Application: | WB |
| Reactivity: | Human, Rat |
| Mol.Wt.: | 21 kDa; 21kD(Calculated). |
| Uniprot: | O75638 |
| RRID: | AB_2842522 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9326, RRID:AB_2842522.
Fold/Unfold
Autoimmunogenic cancer/testis antigen NY ESO 2; Autoimmunogenic cancer/testis antigen NY-ESO-2; CAMEL; Cancer/testis antigen 2; Cancer/testis antigen 6.2; CT 2; CT2; CT6.2; CTAG 2; CTAG2; CTAG2_HUMAN; CTL recognized antigen on melanoma; ESO 2; ESO2; L antigen family member 1; LAGE 1; LAGE 1a protein; LAGE 2b; LAGE-1; LAGE1; LAGE2b; MGC138724; MGC3803;
Immunogens
A synthesized peptide derived from human CTAG2, corresponding to a region within the internal amino acids.
Testis and very low level in placenta and in some uterus samples. Observed in 25-50% of tumor samples of melanomas, non-small-cell lung carcinomas, bladder, prostate and head and neck cancers.
- O75638 CTAG2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLELHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI
Research Backgrounds
Testis and very low level in placenta and in some uterus samples. Observed in 25-50% of tumor samples of melanomas, non-small-cell lung carcinomas, bladder, prostate and head and neck cancers.
Belongs to the CTAG/PCC1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.