Product: CEACAM7 Antibody
Catalog: DF9346
Description: Rabbit polyclonal antibody to CEACAM7
Application: WB IF/ICC
Cited expt.: WB, IF/ICC
Reactivity: Human, Mouse
Mol.Wt.: 29kDa(Observed); 29kD(Calculated).
Uniprot: Q14002
RRID: AB_2842542

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse
Clonality:
Polyclonal
Specificity:
CEACAM7 Antibody detects endogenous levels of total CEACAM7.
RRID:
AB_2842542
Cite Format: Affinity Biosciences Cat# DF9346, RRID:AB_2842542.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Carcinoembryonic antigen CGM 2; Carcinoembryonic antigen CGM2; Carcinoembryonic antigen gene family member 2; Carcinoembryonic antigen related cell adhesion molecule 7; Carcinoembryonic antigen-related cell adhesion molecule 7; CEA; CEACAM 7; CEACAM7; CEAM7_HUMAN; CGM 2; CGM2;

Immunogens

Immunogen:

A synthesized peptide derived from human CEACAM7, corresponding to a region within the internal amino acids.

Uniprot:
Gene(ID):
Expression:
Q14002 CEAM7_HUMAN:

Expressed in columnar epithelial cells of the colon (at protein level) (PubMed:10436421). Strongly down-regulated in colonic adenocarcinomas.

Sequence:
MGSPSACPYRVCIPWQGLLLTASLLTFWNLPNSAQTNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQASSPDLSAGTAVSIMIGVLAGMALI

Research Backgrounds

Subcellular Location:

Cell membrane>Lipid-anchor. Apical cell membrane.
Note: Localized to the apical glycocalyx surface.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in columnar epithelial cells of the colon (at protein level). Strongly down-regulated in colonic adenocarcinomas.

Family&Domains:

Belongs to the immunoglobulin superfamily. CEA family.

References

1). RNA-sequencing expression profile and functional analysis of retinal pigment epithelium in atrophic age-related macular degeneration. Journal of biomedical research, 2024 (PubMed: 38808557) [IF=2.2]

Application: WB    Species: human    Sample: ARPE-19 cells

Figure 6. Validation of the ROS-CPXM2-EMT axis in oxidative stress cell models. A: Representative images of Western blotting (WB) analysis of 4-hydroxynonenal (4-HNE) and CPXM2 in ARPE-19 cells treated with or without H2O2 (200 μmol/L), and the relative quantification of 4-HNE and CPXM2. B: Representative immunofluorescence images and mean fluorescence intensity analysis of CPXM2 in ARPE-19 cells treated with H2O2 (200 μmol/L). Scale bar: 50 μm. C: WB analysis of fibronectin 1 (FN1) and SNAIL in ARPE-19 cells treated with H2O2 (200 μmol/L), and the relative quantification of FN1 and SNAIL expression. D: Representative immunofluorescence images and mean fluorescence intensity analysis of ZO-1 and bestrophin-1 (BEST1) in ARPE-19 cells treated with H2O2 (200 μmol/L). Scale bar: 50 μm. E: Quantitative reverse transcription PCR analyses were performed to detect the expression levels of CPXM2 mRNA in ARPE-19 cells transfected with CPXM2 siRNA (siCPXM2). F: Images of WB analysis of ARPE-19 cells transfected with negative siRNA (siNC) or siCPXM2 and stimulated with PBS or H2O2 (200 μmol/L), and the relative quantification analysis of FN1, CPXM2 and αSMA expression. The data are presented as means with standard errors of the mean from three independent experiments. Student's t-test was applied for comparisons between two groups. ANOVA and Tukey's Honestly-Significant Difference post hoc test were applied for comparisons between the three groups

Application: IF/ICC    Species: human    Sample: ARPE-19 cells

Figure 6. Validation of the ROS-CPXM2-EMT axis in oxidative stress cell models. A: Representative images of Western blotting (WB) analysis of 4-hydroxynonenal (4-HNE) and CPXM2 in ARPE-19 cells treated with or without H2O2 (200 μmol/L), and the relative quantification of 4-HNE and CPXM2. B: Representative immunofluorescence images and mean fluorescence intensity analysis of CPXM2 in ARPE-19 cells treated with H2O2 (200 μmol/L). Scale bar: 50 μm. C: WB analysis of fibronectin 1 (FN1) and SNAIL in ARPE-19 cells treated with H2O2 (200 μmol/L), and the relative quantification of FN1 and SNAIL expression. D: Representative immunofluorescence images and mean fluorescence intensity analysis of ZO-1 and bestrophin-1 (BEST1) in ARPE-19 cells treated with H2O2 (200 μmol/L). Scale bar: 50 μm. E: Quantitative reverse transcription PCR analyses were performed to detect the expression levels of CPXM2 mRNA in ARPE-19 cells transfected with CPXM2 siRNA (siCPXM2). F: Images of WB analysis of ARPE-19 cells transfected with negative siRNA (siNC) or siCPXM2 and stimulated with PBS or H2O2 (200 μmol/L), and the relative quantification analysis of FN1, CPXM2 and αSMA expression. The data are presented as means with standard errors of the mean from three independent experiments. Student's t-test was applied for comparisons between two groups. ANOVA and Tukey's Honestly-Significant Difference post hoc test were applied for comparisons between the three groups

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.