CEACAM7 Antibody - #DF9346
| Product: | CEACAM7 Antibody |
| Catalog: | DF9346 |
| Description: | Rabbit polyclonal antibody to CEACAM7 |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Mol.Wt.: | 29kDa; 29kD(Calculated). |
| Uniprot: | Q14002 |
| RRID: | AB_2842542 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9346, RRID:AB_2842542.
Fold/Unfold
Carcinoembryonic antigen CGM 2; Carcinoembryonic antigen CGM2; Carcinoembryonic antigen gene family member 2; Carcinoembryonic antigen related cell adhesion molecule 7; Carcinoembryonic antigen-related cell adhesion molecule 7; CEA; CEACAM 7; CEACAM7; CEAM7_HUMAN; CGM 2; CGM2;
Immunogens
A synthesized peptide derived from human CEACAM7, corresponding to a region within the internal amino acids.
Expressed in columnar epithelial cells of the colon (at protein level) (PubMed:10436421). Strongly down-regulated in colonic adenocarcinomas.
- Q14002 CEAM7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGSPSACPYRVCIPWQGLLLTASLLTFWNLPNSAQTNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQASSPDLSAGTAVSIMIGVLAGMALI
Research Backgrounds
Cell membrane>Lipid-anchor. Apical cell membrane.
Note: Localized to the apical glycocalyx surface.
Expressed in columnar epithelial cells of the colon (at protein level). Strongly down-regulated in colonic adenocarcinomas.
Belongs to the immunoglobulin superfamily. CEA family.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.