Cytokeratin 7 Antibody - #AF0195

(4)   (12)  
Product: Cytokeratin 7 Antibody
Catalog: AF0195
Description: Rabbit polyclonal antibody to Cytokeratin 7
Application: WB IHC IF/ICC
Reactivity: Human
Mol.Wt.: 51kDa; 51kD(Calculated).
Uniprot: P08729
RRID: AB_2833388

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:3000, IHC 1:50-1:200, IF/ICC: 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
Cytokeratin 7 Antibody detects endogenous levels of total Cytokeratin 7.
RRID:
AB_2833388
Cite Format: Affinity Biosciences Cat# AF0195, RRID:AB_2833388.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CK 7; CK-7; CK7; Cytokeratin 7; Cytokeratin-7; D15Wsu77e; K2C7; K2C7_HUMAN; K7; Keratin 7; Keratin 7, type II; Keratin type II cytoskeletal 7; Keratin, 55K type II cytoskeletal; Keratin, simple epithelial; Keratin, simple epithelial type I, K7; Keratin, type II cytoskeletal 7; Keratin-7; Krt2-7; KRT7; MGC11625; MGC129731; MGC3625; Sarcolectin; SCL; Type II mesothelial keratin K7; Type-II keratin Kb7;

Immunogens

Immunogen:
Uniprot:

P08729(K2C7_HUMAN) >>Visit HPA database.

Gene(ID):
KRT7(3855)
Expression:
P08729 K2C7_HUMAN:

Expressed in cultured epidermal, bronchial and mesothelial cells but absent in colon, ectocervix and liver. Observed throughout the glandular cells in the junction between stomach and esophagus but is absent in the esophagus.

Description:
K7 a type II cytoskeletal keratin. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Phosphorylation of keratins at specific sites affects their organization, assembly dynamics, and their interaction with signaling molecules. Specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels
Sequence:
MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINHRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD

PTMs - P08729 As Substrate

Site PTM Type Enzyme
S2 Phosphorylation
S6 Phosphorylation
S7 Phosphorylation
S14 Phosphorylation
S18 Phosphorylation
R20 Methylation
R25 Methylation
S27 Phosphorylation
S28 Phosphorylation
S36 Phosphorylation
S37 Phosphorylation
S38 Phosphorylation
Y40 Phosphorylation
S45 Phosphorylation
R46 Methylation
R48 Methylation
S53 Phosphorylation
Y55 Phosphorylation
T67 Phosphorylation
S71 Phosphorylation
S83 Phosphorylation
K96 Ubiquitination
T97 Phosphorylation
K101 Acetylation
K101 Methylation
K101 Sumoylation
K101 Ubiquitination
S104 Phosphorylation
K108 Acetylation
K108 Ubiquitination
K117 Ubiquitination
K122 Ubiquitination
K130 Sumoylation
K130 Ubiquitination
S134 Phosphorylation
S168 Phosphorylation
K179 Acetylation
Y180 Phosphorylation
K198 Ubiquitination
K199 Acetylation
K199 Ubiquitination
Y205 Phosphorylation
S207 Phosphorylation
K214 Ubiquitination
T227 Phosphorylation
T231 Phosphorylation
T234 Phosphorylation
S238 Phosphorylation
S241 Phosphorylation
T243 Phosphorylation
S244 Phosphorylation
S248 Phosphorylation
S252 Phosphorylation
S254 Phosphorylation
K265 Ubiquitination
Y268 Phosphorylation
K273 Ubiquitination
S275 Phosphorylation
Y283 Phosphorylation
K286 Ubiquitination
T289 Phosphorylation
K296 Acetylation
K296 Ubiquitination
K326 Sumoylation
K326 Ubiquitination
K331 Ubiquitination
K348 Ubiquitination
K353 Ubiquitination
Y375 Phosphorylation
S380 Phosphorylation
K394 Acetylation
K394 Sumoylation
K394 Ubiquitination
S401 Phosphorylation
S456 Phosphorylation
T459 Phosphorylation
S461 Phosphorylation
S463 Phosphorylation
S466 Phosphorylation

Research Backgrounds

Function:

Blocks interferon-dependent interphase and stimulates DNA synthesis in cells. Involved in the translational regulation of the human papillomavirus type 16 E7 mRNA (HPV16 E7).

PTMs:

Arg-20 is dimethylated, probably to asymmetric dimethylarginine.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in cultured epidermal, bronchial and mesothelial cells but absent in colon, ectocervix and liver. Observed throughout the glandular cells in the junction between stomach and esophagus but is absent in the esophagus.

Subunit Structure:

Heterotetramer of two type I and two type II keratins. Interacts with eukaryotic translation initiator factor 3 (eIF3) subunit EIF3S10. Interacts with GPER1.

(Microbial infection) Interacts with human papillomavirus 16/HPV16 protein E7.

Family&Domains:

Belongs to the intermediate filament family.

References

1). An Q et al. KRT7 promotes epithelial‑mesenchymal transition in ovarian cancer via the TGF‑β/Smad2/3 signaling pathway. ONCOLOGY REPORTS 2020 Dec 8;45(2):481-492. (PubMed: 33416175) [IF=4.2]

Application: WB    Species: Human    Sample: ovarian cell

Figure 2. - Effect of KRT7 on HEY and OVCAR433 cell proliferation and colony formation. (A) Protein expression levels of KRT7 in ovarian cell lines were assessed using western blotting. (B) Overexpression of KRT7 in HEY cells was confirmed by western blotting. (C) Overexpression of KRT7 significantly increased the proliferative capacity of HEY cells. (D) Overexpression of KRT7 in HEY cells significantly increased colony formation. (E) Knockdown of KRT7 in OVCAR433 cells was confirmed by western blotting. Knockdown of KRT7 in OVCAR433 cells significantly reduced (F) cell proliferation and (G) colony formation. All experiments were performed at least three times. Results are presented as the mean ± standard deviation. **P<0.01. KRT7, keratin 7; sh, short hairpin RNA; NC, negative control; OD, optical density.

Application: IHC    Species: Human    Sample: ovarian tumor tissues

Figure 1. - KRT7 expression is indicative of a poor prognosis in patients with ovarian cancer. (A) Representative images of KRT7 staining in normal and ovarian tumor tissues, and immunohistochemical score of KRT7 in normal and ovarian tumor tissues. (B) mRNA expression levels of KRT7 in normal and ovarian tumor tissues. Associations between the (C) pathological grades and (D) clinical stages of ovarian cancer with KRT7 expression. (E) Effect of mRNA expression levels of KRT7 on the median survival time of patients with ovarian cancer. (F) Gene Ontology analysis of the differentially expressed genes between the high- and low-expression KRT7 groups in patients with ovarian cancer. Data were obtained from the Human Protein Atlas and The Cancer Genome Atlas database. *P<0.05, **P<0.01. KRT7, keratin 7; ECM, extracellular matrix.
2). Wang R et al. microRNA-210/Long non-coding RNA MEG3 axis inhibits trophoblast cell migration and invasion by suppressing EMT process. PLACENTA 2021 Jun;109:64-71. (PubMed: 33990028) [IF=3.8]
3). Wang J et al. Isolation, culture, and identification of ceruminous gland cells. JOURNAL OF MOLECULAR HISTOLOGY 2022 Feb 3. (PubMed: 35113280) [IF=3.2]
4). Wang J et al. Comparative study of the external auditory canal in humans and large mammals. The Anatomical Record 2021 May 29; (PubMed: 34050614)

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.