DYNLRB1 Antibody - #DF9471
| Product: | DYNLRB1 Antibody |
| Catalog: | DF9471 |
| Description: | Rabbit polyclonal antibody to DYNLRB1 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 11 kDa; 11kD(Calculated). |
| Uniprot: | Q9NP97 |
| RRID: | AB_2842667 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9471, RRID:AB_2842667.
Fold/Unfold
BITH; bithoraxoid like protein; BLP; cytoplasmic dynein light chain 2A; DNCL2A; DNLC2A; dynein associated protein HKM23; dynein associated protein Km23; Dynein light chain 2A, cytoplasmic; dynein, cytoplasmic, light polypeptide 2A; dynein, light chain, roadblock type 1; HSPC162; Roadblock 1; roadblock domain containing 1; Roadblock domain containing protein 1; ROBL/LC7 like 1; ROBLD1;
Immunogens
A synthesized peptide derived from human DYNLRB1, corresponding to a region within the internal amino acids.
High expression in heart, liver, brain and pancreas; moderate in placenta, skeletal muscle and kidney; low in lung, prostate, testis, small intestine and colon. Isoform 1 expression is up-regulated in 64% hepatocellular carcinoma (HCC) patients.
- Q9NP97 DLRB1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.
Cytoplasm>Cytoskeleton.
High expression in heart, liver, brain and pancreas; moderate in placenta, skeletal muscle and kidney; low in lung, prostate, testis, small intestine and colon. Isoform 1 expression is up-regulated in 64% hepatocellular carcinoma (HCC) patients.
Belongs to the GAMAD family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.