DYNLT3 Antibody - #DF9474
| Product: | DYNLT3 Antibody |
| Catalog: | DF9474 |
| Description: | Rabbit polyclonal antibody to DYNLT3 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
| Mol.Wt.: | 13 kDa; 13kD(Calculated). |
| Uniprot: | P51808 |
| RRID: | AB_2842670 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9474, RRID:AB_2842670.
Fold/Unfold
2310075M16Rik; AU042796; DYLT3_HUMAN; Dynein light chain Tctex-type 3; DYNLT3; Protein 91/23; RP23-256J17.2; RP3; T-complex-associated testis-expressed 1-like; Tcte1l; TCTEX1L;
Immunogens
A synthesized peptide derived from human DYNLT3, corresponding to a region within N-terminal amino acids.
- P51808 DYLT3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Probably binds BUB3 as part of transport cargo. Required for the efficient progression through mitosis (By similarity).
Nucleus. Cytoplasm>Cytoskeleton. Chromosome>Centromere>Kinetochore.
Note: Colocalizes with BUB3 at kinetochores specifically during prometaphase.
Belongs to the dynein light chain Tctex-type family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.