NSMCE2 Antibody - #DF9475
| Product: | NSMCE2 Antibody |
| Catalog: | DF9475 |
| Description: | Rabbit polyclonal antibody to NSMCE2 |
| Application: | WB IHC |
| Reactivity: | Human |
| Prediction: | Rabbit |
| Mol.Wt.: | 28 kDa; 28kD(Calculated). |
| Uniprot: | Q96MF7 |
| RRID: | AB_2842671 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9475, RRID:AB_2842671.
Fold/Unfold
C8orf36; E3 SUMO-protein ligase NSE2; hMMS21; hNSE2; methyl methanesulfonate sensitivity gene 21; MMS21; MMS21 homolog; non-SMC element 2; Non-SMC element 2 homolog; Non-structural maintenance of chromosomes element 2 homolog; NSE2_HUMAN; Nsmce2;
Immunogens
A synthesized peptide derived from human NSMCE2, corresponding to a region within C-terminal amino acids.
- Q96MF7 NSE2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPGRSSSNSGSTGFISFSGVESALSSLKNFQACINSGMDTASSVALDLVESQTEVSSEYSMDKAMVEFATLDRQLNHYVKAVQSTINHVKEERPEKIPDLKLLVEKKFLALQSKNSDADFQNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDEDIIVTQSQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKKRHRHSE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
E3 SUMO-protein ligase component of the SMC5-SMC6 complex, a complex involved in DNA double-strand break repair by homologous recombination. Is not be required for the stability of the complex. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination in ALT (alternative lengthening of telomeres) cell lines and mediates sumoylation of shelterin complex (telosome) components which is proposed to lead to shelterin complex disassembly in ALT-associated PML bodies (APBs). Acts as an E3 ligase mediating SUMO attachment to various proteins such as SMC6L1 and TRAX, the shelterin complex subunits TERF1, TERF2, TINF2 and TERF2IP, and maybe the cohesin components RAD21 and STAG2. Required for recruitment of telomeres to PML nuclear bodies. SUMO protein-ligase activity is required for the prevention of DNA damage-induced apoptosis by facilitating DNA repair, and for formation of APBs in ALT cell lines. Required for sister chromatid cohesion during prometaphase and mitotic progression.
Sumoylated, possibly via autosumoylation.
Nucleus. Chromosome>Telomere. Nucleus>PML body.
Note: Localizes to PML nuclear bodies in ALT cell lines.
Belongs to the NSE2 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.