ZNRF1 Antibody - #DF9492
| Product: | ZNRF1 Antibody |
| Catalog: | DF9492 |
| Description: | Rabbit polyclonal antibody to ZNRF1 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
| Mol.Wt.: | 24 kDa; 24kD(Calculated). |
| Uniprot: | Q8ND25 |
| RRID: | AB_2842688 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9492, RRID:AB_2842688.
Fold/Unfold
B830022L21Rik; DKFZp434E229; E3 ubiquitin protein ligase ZNRF1; E3 ubiquitin-protein ligase ZNRF1; EC 6.3.2.-; FLJ14846; MGC101991; MGC15430; Nerve injury gene 283; Nerve injury induced gene 283 protein; Nerve injury-induced gene 283 protein; NIN283; Rnf42; Zinc and ring finger 1; zinc and ring finger protein 1; zinc finger and ring finger protein 1; Zinc/RING finger protein 1; ZNRF 1; znrf1; ZNRF1_HUMAN; Zrfp1;
Immunogens
A synthesized peptide derived from human ZNRF1, corresponding to a region within the internal amino acids.
Expressed primarily in the nervous system, with expression higher in developing brain relative to adult. Expressed at low levels in testis and thymus.
- Q8ND25 ZNRF1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTGGGAMGLRSRSVSSVAGMGMDPSTAGGVPFGLYTPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTKDAGECVICLEELLQGDTIARLPCLCIYHKSCIDSWFEVNRSCPEHPAD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
E3 ubiquitin-protein ligase that mediates the ubiquitination of AKT1 and GLUL, thereby playing a role in neuron cells differentiation. Plays a role in the establishment and maintenance of neuronal transmission and plasticity. Regulates Schwann cells differentiation by mediating ubiquitination of GLUL. Promotes neurodegeneration by mediating 'Lys-48'-linked polyubiquitination and subsequent degradation of AKT1 in axons: degradation of AKT1 prevents AKT1-mediated phosphorylation of GSK3B, leading to GSK3B activation and phosphorylation of DPYSL2/CRMP2 followed by destabilization of microtubule assembly in axons (Probable).
Endosome. Lysosome. Membrane>Peripheral membrane protein. Cytoplasmic vesicle>Secretory vesicle>Synaptic vesicle membrane>Peripheral membrane protein.
Note: Associated with synaptic vesicle membranes in neurons.
Expressed primarily in the nervous system, with expression higher in developing brain relative to adult. Expressed at low levels in testis and thymus.
The RING-type zinc finger domain is required for E3 ligase activity.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.