NEIL2 Antibody - #DF9499
| Product: | NEIL2 Antibody |
| Catalog: | DF9499 |
| Description: | Rabbit polyclonal antibody to NEIL2 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 37 kDa; 37kD(Calculated). |
| Uniprot: | Q969S2 |
| RRID: | AB_2842695 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9499, RRID:AB_2842695.
Fold/Unfold
DNA glycosylase/AP lyase Neil2; DNA-(apurinic or apyrimidinic site) lyase Neil2; Endonuclease 8-like 2; Endonuclease VIII-like 2; NEH2; Nei endonuclease VIII like 2 (E. coli); Nei endonuclease VIII like 2; Nei homolog 2; Nei-like 2; Nei-like protein 2; NEI2; NEIL2; NEIL2_HUMAN;
Immunogens
A synthesized peptide derived from human NEIL2, corresponding to a region within the internal amino acids.
Detected in testis, skeletal muscle, heart, brain, placenta, lung, pancreas, kidney and liver.
- Q969S2 NEIL2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPTPEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Has DNA glycosylase activity towards 5-hydroxyuracil and other oxidized derivatives of cytosine with a preference for mismatched double-stranded DNA (DNA bubbles). Has low or no DNA glycosylase activity towards thymine glycol, 2-hydroxyadenine, hypoxanthine and 8-oxoguanine. Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates.
Nucleus.
Detected in testis, skeletal muscle, heart, brain, placenta, lung, pancreas, kidney and liver.
The zinc-finger domain is important for DNA binding.
Belongs to the FPG family.
Research Fields
· Genetic Information Processing > Replication and repair > Base excision repair.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.