Cyclin H Antibody - #AF0088
| Product: | Cyclin H Antibody |
| Catalog: | AF0088 |
| Description: | Rabbit polyclonal antibody to Cyclin H |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 36kDa; 38kD(Calculated). |
| Uniprot: | P51946 |
| RRID: | AB_2833273 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0088, RRID:AB_2833273.
Fold/Unfold
6330408H09Rik; AI661354; AV102684; AW538719; CAK; CAK complex subunit; ccnh; CCNH_HUMAN; CDK activating kinase; CDK activating kinase complex subunit; Cyclin dependent kinase activating kinase; cyclin dependent kinase activating kinase complex subunit; Cyclin H; Cyclin-H; CyclinH; MO15 associated protein; MO15-associated protein; p34; p36; p37;
Immunogens
A synthesized peptide derived from human Cyclin H, corresponding to a region within C-terminal amino acids.
- P51946 CCNH_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Regulates CDK7, the catalytic subunit of the CDK-activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminal domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Involved in cell cycle control and in RNA transcription by RNA polymerase II. Its expression and activity are constant throughout the cell cycle.
Nucleus.
Belongs to the cyclin family. Cyclin C subfamily.
Research Fields
· Cellular Processes > Cell growth and death > Cell cycle. (View pathway)
· Genetic Information Processing > Transcription > Basal transcription factors.
· Genetic Information Processing > Replication and repair > Nucleotide excision repair.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.