TGIF2LX Antibody - #DF9593
| Product: | TGIF2LX Antibody |
| Catalog: | DF9593 |
| Description: | Rabbit polyclonal antibody to TGIF2LX |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 27 kDa; 27kD(Calculated). |
| Uniprot: | Q8IUE1 |
| RRID: | AB_2842789 |
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9593, RRID:AB_2842789.
Fold/Unfold
Homeobox protein TGIF2LX; MGC130458; testis expressed homeobox Tex1; Tex1; TF2LX_HUMAN; TGF; TGF beta induced transcription factor like protein; TGF(beta) induced transcription factor 2 like; TGF-beta-induced transcription factor 2-like protein; TGFB induced factor 2 like protein X linked; TGFB induced factor homeobox 2 like, X linked; TGFB-induced factor 2-like protein; TGIF homeobox 1; TGIF-like on the X; TGIF2LX; TGIFLX; Tgifx1; X-linked;
Immunogens
A synthesized peptide derived from human TGIF2LX, corresponding to a region within the internal amino acids.
- Q8IUE1 TF2LX_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHKKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGPSGPDNVQSLPLWPLPKGQMSREKQPDPESAPSQKLTGIAQPKKKVKVSVTSPSSPELVSPEEHADFSSFLLLVDAAVQRAAELELEKKQEPNP
Research Backgrounds
May have a transcription role in testis.
Nucleus.
Specifically expressed in adult testis.
Belongs to the TALE/TGIF homeobox family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.