MRPS28 Antibody - #DF9625
| Product: | MRPS28 Antibody |
| Catalog: | DF9625 |
| Description: | Rabbit polyclonal antibody to MRPS28 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Rabbit |
| Mol.Wt.: | 21 kDa; 21kD(Calculated). |
| Uniprot: | Q9Y2Q9 |
| RRID: | AB_2842821 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9625, RRID:AB_2842821.
Fold/Unfold
28S ribosomal protein S28; 28S ribosomal protein S35; HSPC007; Mitochondrial 28S ribosomal protein S35; mitochondrial; Mitochondrial ribosomal protein S28; MRP-S28; MRP-S35; MRPS 28; mrps28; MRPS35; RT28_HUMAN; S28mt; S35mt;
Immunogens
A synthesized peptide derived from human MRPS28, corresponding to a region within C-terminal amino acids.
- Q9Y2Q9 RT28_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQKGSPKNVESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGIQESKDSRSKEEHHEK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Mitochondrion.
Belongs to the bacterial ribosomal protein bS1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.