SCG5 Antibody - #DF9688
| Product: | SCG5 Antibody |
| Catalog: | DF9688 |
| Description: | Rabbit polyclonal antibody to SCG5 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Dog, Chicken, Xenopus |
| Mol.Wt.: | 24 kDa; 24kD(Calculated). |
| Uniprot: | P05408 |
| RRID: | AB_2842884 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9688, RRID:AB_2842884.
Fold/Unfold
7B2; 7B2 protein; APPG; Neuroendocrine protein 7B2; P7B2; Pituitary polypeptide; Prohormone convertase chaperone; SCG 5; SCG5; Secretogranin 5; Secretogranin V 7B2 protein; Secretogranin5; SecretograninV; Secretory granule endocrine protein I; Secretory granule neuroendocrine protein 1 7B2 protein; Secretory granule neuroendocrine protein 1; Sg V; SGNE 1; SGNE1; SgV;
Immunogens
A synthesized peptide derived from human SCG5, corresponding to a region within the internal amino acids.
- P05408 7B2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSVPHFSDEDKDPE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Acts as a molecular chaperone for PCSK2/PC2, preventing its premature activation in the regulated secretory pathway. Binds to inactive PCSK2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secretory pathway where it is proteolytically matured and activated. Also required for cleavage of PCSK2 but does not appear to be involved in its folding. Plays a role in regulating pituitary hormone secretion. The C-terminal peptide inhibits PCSK2 in vitro.
Proteolytically cleaved in the Golgi by a furin-like convertase to generate bioactive peptides.
Sulfated on tyrosine residues.
Secreted.
Note: Neuroendocrine and endocrine secretory granules.
Belongs to the 7B2 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.