SERPINA10 Antibody - #DF9787
| Product: | SERPINA10 Antibody |
| Catalog: | DF9787 |
| Description: | Rabbit polyclonal antibody to SERPINA10 |
| Application: | WB IHC |
| Reactivity: | Human, Rat, Monkey |
| Mol.Wt.: | 51 kDa; 51kD(Calculated). |
| Uniprot: | Q9UK55 |
| RRID: | AB_2842982 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9787, RRID:AB_2842982.
Fold/Unfold
Protein Z dependent protease inhibitor; Protein Z dependent protease inhibitor precursor; Protein Z-dependent protease inhibitor; PZ dependent protease inhibitor; PZ-dependent protease inhibitor; PZI; serine (or cysteine) proteinase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 10; Serpin A10; Serpin peptidase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 10; SERPINA 10; SERPINA10; ZPI; ZPI_HUMAN;
Immunogens
A synthesized peptide derived from human SERPINA10, corresponding to a region within N-terminal amino acids.
- Q9UK55 ZPI_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MKVVPSLLLSVLLAQVWLVPGLAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMASRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFDKNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPFHFMIYEETSGMLLFLGRVVNPTLL
Research Backgrounds
Inhibits activity of the coagulation protease factor Xa in the presence of PROZ, calcium and phospholipids. Also inhibits factor XIa in the absence of cofactors.
Phosphorylated by FAM20C in the extracellular medium.
Secreted.
Expressed by the liver and secreted in plasma.
Belongs to the serpin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.