RABL2B Antibody - #DF9797
Product: | RABL2B Antibody |
Catalog: | DF9797 |
Description: | Rabbit polyclonal antibody to RABL2B |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 26 kDa; 26kD(Calculated). |
Uniprot: | Q9UNT1 |
RRID: | AB_2842991 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9797, RRID:AB_2842991.
Fold/Unfold
FLJ78724; FLJ93981; FLJ98216; MGC117180; OTTHUMP00000045491; OTTHUMP00000045492; OTTHUMP00000045493; OTTHUMP00000203788; OTTHUMP00000203792; RAB like 2B; RAB like protein 2B; RAB member of RAS oncogene family like 2B; Rab-like protein 2A; RABL2A; RABL2B; RBL2A_HUMAN; RP11-395L14.2;
Immunogens
A synthesized peptide derived from human RABL2B, corresponding to a region within C-terminal amino acids.
- Q9UNT1 RBL2B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGRTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDDINVTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPSEEAASPHS
Research Backgrounds
Small GTPase required for ciliation. Activated in a guanine nucleotide exchange factor (GEF)-independent manner via its intrinsic GDP for GTP nucleotide exchange ability. Involved in ciliary assembly by binding the intraflagellar transport (IFT) complex B from the large pool pre-docked at the base of the cilium and thus triggers its entry into the cilia.
Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome>Centriole. Cytoplasm>Cytoskeleton>Cilium basal body. Cytoplasm.
Note: Localizes on the mother centriole. Localizes slightly apical to the subdistal appendage, but below the distal appendage.
Expressed in the testis.
Belongs to the small GTPase superfamily. Rab family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.