RAB1A Antibody - #DF9817
| Product: | RAB1A Antibody |
| Catalog: | DF9817 |
| Description: | Rabbit polyclonal antibody to RAB1A |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 23 kDa; 23kD(Calculated). |
| Uniprot: | P62820 |
| RRID: | AB_2843011 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9817, RRID:AB_2843011.
Fold/Unfold
GTP binding protein RAB 1A; mKIAA3012; RAB 1; Rab 1A; RAB1; RAB1, member RAS oncogene family; Rab1A; RAB1A member RAS oncogene family; RAB1A_HUMAN; Ras related protein Rab 1A; Ras-associated protein RAB1; Ras-related protein Rab-1A; YPT1; YPT1 related protein; YPT1-related protein;
Immunogens
A synthesized peptide derived from human RAB1A, corresponding to a region within C-terminal amino acids.
- P62820 RAB1A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB1A regulates vesicular protein transport from the endoplasmic reticulum (ER) to the Golgi compartment and on to the cell surface, and plays a role in IL-8 and growth hormone secretion. Regulates the level of CASR present at the cell membrane. Plays a role in cell adhesion and cell migration, via its role in protein trafficking. Plays a role in autophagosome assembly and cellular defense reactions against pathogenic bacteria. Plays a role in microtubule-dependent protein transport by early endosomes and in anterograde melanosome transport.
Phosphorylated by CDK1 kinase during mitosis.
Phosphocholinated at Ser-79 by L.pneumophila AnkX, leading to displace GDP dissociation inhibitors (GDI). Both GDP-bound and GTP-bound forms can be phosphocholinated. Dephosphocholinated by L.pneumophila Lem3, restoring accessibility to L.pneumophila GTPase effector LepB.
Golgi apparatus. Endoplasmic reticulum. Early endosome. Cytoplasm>Cytosol. Membrane. Melanosome.
Note: Alternates between membrane-associated and cytosolic forms.
Belongs to the small GTPase superfamily. Rab family.
Research Fields
· Human Diseases > Infectious diseases: Bacterial > Legionellosis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.